[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70389.1
DDBJ      :             putative membrane protein
Swiss-Prot:MARC_SALTY   RecName: Full=UPF0056 inner membrane protein marC;

Homologs  Archaea  28/68 : Bacteria  384/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:221 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->213 PF01914 * MarC 1e-30 43.8 %
:HMM:PFM   5->217 PF01914 * MarC 2.7e-70 40.9 203/203  
:BLT:SWISS 1->221 MARC_SALTY e-123 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70389.1 GT:GENE ACF70389.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1645328..1645993 GB:FROM 1645328 GB:TO 1645993 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:NOTE identified by match to protein family HMM PF01914; match to protein family HMM TIGR00427 GB:PROTEIN_ID ACF70389.1 GB:DB_XREF GI:194410170 LENGTH 221 SQ:AASEQ MMDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSYMASVYVFAIMMVAYYAGQLVMNTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAHESPEAKSKSEELADEPTANIAFVPLAMPSTAGPGTIAMIISSASTVRHGGEFPDWVIMVAPPIIFLAVAVILWGCLRSSGAIMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVLEIIKTYH GT:EXON 1|1-221:0| SW:ID MARC_SALTY SW:DE RecName: Full=UPF0056 inner membrane protein marC; SW:GN Name=marC; OrderedLocusNames=STM1521; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->221|MARC_SALTY|e-123|100.0|221/221| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 8->30| TM:REGION 47->69| TM:REGION 72->94| TM:REGION 119->141| TM:REGION 152->174| TM:REGION 196->218| RP:PFM:NREP 1 RP:PFM:REP 10->213|PF01914|1e-30|43.8|194/203|MarC| HM:PFM:NREP 1 HM:PFM:REP 5->217|PF01914|2.7e-70|40.9|203/203|MarC| OP:NHOMO 645 OP:NHOMOORG 413 OP:PATTERN ----------------1------------------2111111111-211111-11111111-221--- 111-1-----------------------------------------------1--------------111------------------1122-111-----1111-2-11--------------111---1---------------11--11---11----1---11----------------111----1--1-----------------11-1--------------------------------------------------------11------1111---1------------------------------------------------------------------------------1-------1--222------111----1-----11111111111-22-22-1-11--11111111111121111112111111-1111111131111--2------------------------------1-1-113311344433333333334333323333111111222122---1121-113-11145--------1--1---1--112-11112-2-2---11122-21--------1111-1----------11-111332-111-1-122222222222322323311-1-1-112-11121121312222222222-222222222222222222222222112222222222222222232212222-133333333333311--11111------2-12221121----2112-------112-12232111121111-111----------11131111122311--11-11111--1-1--------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,92-118,221-222| PSIPRED cHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //