[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70421.1
DDBJ      :             putative membrane protein
Swiss-Prot:YQAA_SHIFL   RecName: Full=Inner membrane protein yqaA;

Homologs  Archaea  3/68 : Bacteria  236/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   41->123 PF09335 * SNARE_assoc 1e-07 39.8 %
:HMM:PFM   26->132 PF09335 * SNARE_assoc 8e-16 27.6 105/123  
:BLT:SWISS 22->141 YQAA_SHIFL 2e-65 92.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70421.1 GT:GENE ACF70421.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2943079..2943504) GB:FROM 2943079 GB:TO 2943504 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID ACF70421.1 GB:DB_XREF GI:194410202 LENGTH 141 SQ:AASEQ MSDGLSLLSLFASSFLSATLLPGNSEVVLVAMLVSGVSHPWVLVLTATMGNSLGGVTNVILGRFFPLRKTSRWQEKATGWLKRYGAATLLLSWMPVIGDLLCLLAGWMRIPWGRTIFFLCLGKALRYVALAAATVQGMMWW GT:EXON 1|1-141:0| SW:ID YQAA_SHIFL SW:DE RecName: Full=Inner membrane protein yqaA; SW:GN Name=yqaA; OrderedLocusNames=SF2716, S2903; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 22->141|YQAA_SHIFL|2e-65|92.5|120/142| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 4->26| TM:REGION 28->50| TM:REGION 85->107| TM:REGION 115->137| SEG 5->21|lsllslfassflsatll| RP:PFM:NREP 1 RP:PFM:REP 41->123|PF09335|1e-07|39.8|83/119|SNARE_assoc| HM:PFM:NREP 1 HM:PFM:REP 26->132|PF09335|8e-16|27.6|105/123|SNARE_assoc| OP:NHOMO 247 OP:NHOMOORG 241 OP:PATTERN --------------------------------------------------111--------------- ------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1--111-1131--211----1-------1---------------1------------------------------1-----111-1111111-----11--------11-1111111111111111111111-1---11-------111--1-1211-1--------1111111-1----1---1--------------------------111111-1-111111111-111111--111---1--1------11111111111111111-111111111111111111111111---1111111111-1111111111111--111111111111---1---------1-1-1111-11111111--11111111----1111111112111211-----------111111111111111---1-11---------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //