[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70425.1
DDBJ      :             putative cytoplasmic protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.26.1e.29.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   49->90 2cswA PDBj 4e-04 23.8 %
:RPS:SCOP  48->106 1uhtA  b.26.1.2 * 1e-04 22.8 %
:RPS:SCOP  77->142 1iw7D  e.29.1.2 * 6e-04 18.8 %
:HMM:PFM   48->90 PF00498 * FHA 0.00037 25.6 43/68  
:BLT:SWISS 87->185 DJC14_BOVIN 8e-04 29.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70425.1 GT:GENE ACF70425.1 GT:PRODUCT putative cytoplasmic protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(317691..318581) GB:FROM 317691 GB:TO 318581 GB:DIRECTION - GB:PRODUCT putative cytoplasmic protein GB:PROTEIN_ID ACF70425.1 GB:DB_XREF GI:194410206 LENGTH 296 SQ:AASEQ MWELRKIQSQGITDNAQYPAGTYIVFTAAAPYIPLFEQHGKDDIALSLVRHEEAWWIVNHSDELCCAVNEQVMEPHHRMRLNDGDTIEWGLSSWCLARTNDESRPDVSFPQLVQSSESVAEYLDLDWFKQQQLNPQNPFDIIPVRETASSYTGHEADSTLHQLYQEYQQALRPSGQEKPLRPKPFPRNEDAVTQDLTSLYDKKGDTDTLQDMVAGAPGIDAILDTLDTTGEGEMHWLAMESMPDILQLLPPEQAGKTAHSEILPDLTRREHRIIGIDSHYRITPTQKNGNTAHEKN GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 87->185|DJC14_BOVIN|8e-04|29.2|89/100| RP:PDB:NREP 1 RP:PDB:REP 49->90|2cswA|4e-04|23.8|42/145| HM:PFM:NREP 1 HM:PFM:REP 48->90|PF00498|0.00037|25.6|43/68|FHA| RP:SCP:NREP 2 RP:SCP:REP 48->106|1uhtA|1e-04|22.8|57/118|b.26.1.2| RP:SCP:REP 77->142|1iw7D|6e-04|18.8|64/1392|e.29.1.2| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11-1111-1----221------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 27.4 SQ:SECSTR ################################################EcTTccEEEEcccccccEEEcccccccTccEEccccccEEEc##ccTTTTccccEEcccccccccccccccccccEEEccHHH##################################################################################################################################################################### DISOP:02AL 1-3,5-5,7-7,177-179,181-181,287-297| PSIPRED cccHHHHHHcccccccccccccEEEEEEccccEEEEEEccccEEEEEEEEcccEEEEEcccccEEEEccHHHccHHHHEEcccccEEEEccccEEEEcccccccccccHHHHHHHHHHHHHHHcHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHHcccccccccccHHcccHHHHHHccHHHccHHHccccccHHHHcccEEEEEEccEEEcccccccccccccc //