[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70452.1
DDBJ      :             ferric enterobactin transport ATP-binding protein FepC
Swiss-Prot:FEPC_ECOLI   RecName: Full=Ferric enterobactin transport ATP-binding protein fepC;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
b.40.4c.37.1
:264 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   17->231 2it1B PDBj 2e-25 32.5 %
:RPS:PDB   7->242 3dmdC PDBj 8e-35 10.7 %
:RPS:SCOP  8->46 2vnuD1  b.40.4.5 * 6e-06 17.9 %
:RPS:SCOP  21->242 1l7vC  c.37.1.12 * 3e-30 28.0 %
:HMM:SCOP  8->230 1pf4A1 c.37.1.12 * 2.3e-59 36.5 %
:RPS:PFM   57->172 PF00005 * ABC_tran 7e-11 33.6 %
:HMM:PFM   47->172 PF00005 * ABC_tran 2.5e-22 29.3 116/118  
:HMM:PFM   32->53 PF02463 * SMC_N 3.4e-06 54.5 22/220  
:BLT:SWISS 1->263 FEPC_ECOLI e-133 92.0 %
:PROS 144->158|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70452.1 GT:GENE ACF70452.1 GT:PRODUCT ferric enterobactin transport ATP-binding protein FepC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(699215..700009) GB:FROM 699215 GB:TO 700009 GB:DIRECTION - GB:PRODUCT ferric enterobactin transport ATP-binding protein FepC GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF70452.1 GB:DB_XREF GI:194410233 LENGTH 264 SQ:AASEQ MTESVARLRGNQLTLGYGSYTVAKNLNVSIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPVDGHVWLDGEQIQRYASKEVARRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRWRKEDADAVASAMRATGITSLAAQSVDTLSGGQRQRAWIAMVLAQETSIMLLDEPTTWLDISHQIDLLELLSDLNREKGYTLAAVLHDLNQACRYATHLIALREGNIVAQGAPKEIVTAELIEKIYGLRCMIIDDPVAGTPLVVPLGRR GT:EXON 1|1-264:0| SW:ID FEPC_ECOLI SW:DE RecName: Full=Ferric enterobactin transport ATP-binding protein fepC; SW:GN Name=fepC; OrderedLocusNames=b0588, JW0580; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Ion transport; Iron; Iron transport; Membrane; Nucleotide-binding;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->263|FEPC_ECOLI|e-133|92.0|263/271| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0006826|"GO:iron ion transport"|Iron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 144->158|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 47->56|stllrtlsrl| BL:PDB:NREP 1 BL:PDB:REP 17->231|2it1B|2e-25|32.5|209/361| RP:PDB:NREP 1 RP:PDB:REP 7->242|3dmdC|8e-35|10.7|215/318| RP:PFM:NREP 1 RP:PFM:REP 57->172|PF00005|7e-11|33.6|113/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 47->172|PF00005|2.5e-22|29.3|116/118|ABC_tran| HM:PFM:REP 32->53|PF02463|3.4e-06|54.5|22/220|SMC_N| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 8->46|2vnuD1|6e-06|17.9|39/95|b.40.4.5| RP:SCP:REP 21->242|1l7vC|3e-30|28.0|211/231|c.37.1.12| HM:SCP:REP 8->230|1pf4A1|2.3e-59|36.5|219/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 38079 OP:NHOMOORG 1171 OP:PATTERN OOH8HDGEMNNLNKQHbDLMEIERoORacOdSE8DBBAEDD9AOTLReKN*oc8MWMPRLMGDBS146 MUgG*ZUahhfSVSSPPIH-HZ99U*JJJJJLngihl***MuQ*lunZkdYKnqjNRc77mnmg*kt***YTSRRkTTVMwbd7798BNMPH3LCFF--BAJFEIUGQIL67787777A87777GQNDQSJHNLQKciippGGFmUiUahVUcUZOPLDIEIBZXSd**yQDLGFDBDNEGBDTSVIIeb9UXp********q********qqvv***ahr*ubYgjiehg**TccbbbaXbbcccbbQVSVRmVVRnjSKOORmkJKjlRLKTdXVaYeggmgekmjjhhfheffkgfgZXWWWZZZYYXWXqbdWVWfdgdX*n*********Z*ZevwwSaXU*gdZZxTdPK**jaPaYbQYbZeXKXZTISQNNGIKJHKUR***NOj****u**z**y*yy**-el*fZ*f***R9**************EIIu*********LKLLLLLLfOTGPbS*44323333334556883544444455255F89BAA***x*******ptrtp*****vxxcz***vt*x7Hpqlwciej*q****TcdGPGJkNHHFFFEFMIISdaRt*OYVedSdlWVdEWTTNNUaPOPOLOdnWuIEHKBFFFGHD788888888CLCBCHGjhlLkNTEMGfMPRSQIOXQONRNQTRTUT5-CKQML22-222*l**Q*olssumvvvkk-rlllqoskrnsvpllkllh*****fcVgfeeefffffcegeee*gbhhhikS1************34DDCEBCDFFFGHG*i*VVUTTSHLMKIQJMWLNPONFOHMVfWnplnm*x*p**ruc***9CC9BBCBCHbhgwfhgghqvttsJKMILIHFFG877742HNIIEFEG67796896*AI99998-678889888899GA87887PZcIHezffdCTK -222JD8-G9138EGB8865EFAF9IC886767GFF5A8999955696CGC6F8A8E56A7963233422434634514534434334-8A688338666539GDC2ENKPBFBKHE75539G8QT6U1f*K1LDMA772L3AHI3C886J65o8KGEd9G*4aBL4MHKvKOH6656A*3525BRNRs6OOA8YOSQ7 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,263-265| PSIPRED cccccEEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHHccHHHHHHHccEEcccccccccccHHHHHHccccccHHHcccccHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHccEEEEEEcccccEEEEEEcccc //