[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70456.1
DDBJ      :             protein SgcE
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  860/915 : Eukaryota  176/199 : Viruses  0/175   --->[See Alignment]
c.1.2c.55.3
:210 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->200 1rpxA PDBj 2e-22 30.5 %
:RPS:PDB   1->197 3ct7A PDBj 9e-16 27.6 %
:RPS:SCOP  1->159 1xhxA1  c.55.3.5 * 1e-20 9.2 %
:HMM:SCOP  1->212 2fliA1 c.1.2.2 * 1.5e-41 30.2 %
:RPS:PFM   2->195 PF00834 * Ribul_P_3_epim 4e-27 33.5 %
:HMM:PFM   3->196 PF00834 * Ribul_P_3_epim 8.4e-67 37.6 194/201  
:BLT:SWISS 1->210 SGCE_ECOLI 4e-74 66.7 %
:PROS 30->44|PS01085|RIBUL_P_3_EPIMER_1
:PROS 132->154|PS01086|RIBUL_P_3_EPIMER_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70456.1 GT:GENE ACF70456.1 GT:PRODUCT protein SgcE GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1754004..1754636 GB:FROM 1754004 GB:TO 1754636 GB:DIRECTION + GB:PRODUCT protein SgcE GB:NOTE identified by match to protein family HMM PF00834 GB:PROTEIN_ID ACF70456.1 GB:DB_XREF GI:194410237 LENGTH 210 SQ:AASEQ MILHPSLASADPLRYAEALTALHDAPLGSLHLDIEDTSFINNITFGMKTIQAVAQHTRHPLSLHLMVSSPQRWLPWLAAIRPGWIFIHAESVQNPSEILADIRAIGAKAGLALNPATPLLSYRYLALQLDALMIMTSEPDGRGQQFIATMCEKVSQSREHFPAAECWADGGITLRAARLLAAAGAQHLVIGRALFTTANYNVTLSQFTAL GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 1->210|SGCE_ECOLI|4e-74|66.7|210/210| PROS 30->44|PS01085|RIBUL_P_3_EPIMER_1|PDOC00833| PROS 132->154|PS01086|RIBUL_P_3_EPIMER_2|PDOC00833| SEG 174->185|lraarllaaaga| BL:PDB:NREP 1 BL:PDB:REP 1->200|1rpxA|2e-22|30.5|200/230| RP:PDB:NREP 1 RP:PDB:REP 1->197|3ct7A|9e-16|27.6|196/219| RP:PFM:NREP 1 RP:PFM:REP 2->195|PF00834|4e-27|33.5|194/201|Ribul_P_3_epim| HM:PFM:NREP 1 HM:PFM:REP 3->196|PF00834|8.4e-67|37.6|194/201|Ribul_P_3_epim| GO:PFM:NREP 2 GO:PFM GO:0004750|"GO:ribulose-phosphate 3-epimerase activity"|PF00834|IPR000056| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00834|IPR000056| RP:SCP:NREP 1 RP:SCP:REP 1->159|1xhxA1|1e-20|9.2|152/183|c.55.3.5| HM:SCP:REP 1->212|2fliA1|1.5e-41|30.2|212/0|c.1.2.2|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1319 OP:NHOMOORG 1049 OP:PATTERN -----------------------------1-----11111111------------------111--1- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111211---1111111111111111111111111111111111111111111121111111111111111211111111111111111111111111111111111111111111111111112111111111115556541111111111111111111111111112111111111211211111221211111111211112212121111111111111111111111211114111111111112111111111111211121111111111121111111111111111112121111111211111111111-11111111111121111111112211111111111111111111111211111211111111111---------------1111111111111111111111111111111111111122132111112211112112-11111111111111111111111111111111111111111111111111111111-1111111111111111111111111131111111111111111111111111111-1111111111121111113112322211-1332222121132333332313111112122222233222222111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111--------111--------1--------1-------1111111111221 11--11--521111111111111----111---1111111111-11-1111111-111111111111111111-11111111111111-1-111121-11111111116122111122-1111233132GI3-3212122212122211-1223-111221311111111-11112213a3432142521522222134 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 99.5 SQ:SECSTR cEEEEcGGGccGGGHHHHHHHHHHTTcccEEEEEEcccccccccccHHHHHHHHTTccccEEEEEEcccGGGTHHHHHHHTccEEEEcGGcTTTHHHHHHHHHHTTcEEEEEEcTTccGGGGTTTGGGccEEEEEcccTTcccccccTTHHHHHHHHHHHTcccEEEEEccccTTTHHHHHHHTccEEEEcTTTTGGccHHHHHHHHEE# PSIPRED cEEEHHHHcccHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHccccccEEEEEEEccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHccccEEEEEEHHHccccHHHHHHHHHcc //