[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70464.1
DDBJ      :             30S ribosomal protein, S22 family
Swiss-Prot:SRA_SALTY    RecName: Full=Stationary-phase-induced ribosome-associated protein;         Short=SRA;AltName: Full=30S ribosomal protein S22;

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:47 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->44 PF08136 * Ribosomal_S22 5e-11 93.2 %
:HMM:PFM   1->47 PF08136 * Ribosomal_S22 1.9e-41 100.0 47/47  
:BLT:SWISS 1->47 SRA_SALTY 6e-23 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70464.1 GT:GENE ACF70464.1 GT:PRODUCT 30S ribosomal protein, S22 family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1694341..1694484 GB:FROM 1694341 GB:TO 1694484 GB:DIRECTION + GB:PRODUCT 30S ribosomal protein, S22 family GB:NOTE identified by match to protein family HMM PF08136 GB:PROTEIN_ID ACF70464.1 GB:DB_XREF GI:194410245 LENGTH 47 SQ:AASEQ MKSNRQARHILGLDYRISNQRKVVTEGDTSSVVNNPTGRKRRADSQK GT:EXON 1|1-47:0| SW:ID SRA_SALTY SW:DE RecName: Full=Stationary-phase-induced ribosome-associated protein; Short=SRA;AltName: Full=30S ribosomal protein S22; SW:GN Name=sra; Synonyms=rpsV; OrderedLocusNames=STM1565; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->47|SRA_SALTY|6e-23|100.0|47/47| RP:PFM:NREP 1 RP:PFM:REP 1->44|PF08136|5e-11|93.2|44/45|Ribosomal_S22| HM:PFM:NREP 1 HM:PFM:REP 1->47|PF08136|1.9e-41|100.0|47/47|Ribosomal_S22| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF08136|IPR012607| GO:PFM GO:0005840|"GO:ribosome"|PF08136|IPR012607| GO:PFM GO:0006412|"GO:translation"|PF08136|IPR012607| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111-11-111111----1--11111-111-----11111-1-1-111111-11----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-9,33-48| PSIPRED cccccHHHEEEcccEEEcccEEEEEcccccccccccccccccccccc //