[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ACF70474.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->47 PF03887 * YfbU 0.00022 30.0 40/166  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70474.1 GT:GENE ACF70474.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3109109..3109276) GB:FROM 3109109 GB:TO 3109276 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF70474.1 GB:DB_XREF GI:194410255 LENGTH 55 SQ:AASEQ MFNLKNHRLNARIKLLLRKRSAVTYFSSLPVLKNIIKSGHLSAREMAVVWFIVAN GT:EXON 1|1-55:0| HM:PFM:NREP 1 HM:PFM:REP 2->47|PF03887|0.00022|30.0|40/166|YfbU| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-1111----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-7| PSIPRED ccccccccccEEEEEEEEcccHHHHHHccHHHHHHHHHcccccEEEEEEEEEEcc //