[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ansA
DDBJ      :ansA         L-asparaginase 1
Swiss-Prot:ASPG1_ECOLI  RecName: Full=L-asparaginase 1;         EC=3.5.1.1;AltName: Full=L-asparaginase I;         Short=L-ASNase I;AltName: Full=L-asparagine amidohydrolase I;

Homologs  Archaea  68/68 : Bacteria  490/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
c.88.1
:362 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->361 2p2dC PDBj 0.0 94.6 %
:RPS:PDB   5->360 2d6fA PDBj 1e-60 27.1 %
:RPS:SCOP  28->360 1zq1A2  c.88.1.1 * 2e-89 29.9 %
:HMM:SCOP  21->360 2d6fA2 c.88.1.1 * 3.8e-109 44.0 %
:RPS:PFM   30->344 PF00710 * Asparaginase 2e-83 53.9 %
:HMM:PFM   30->347 PF00710 * Asparaginase 1e-112 46.7 306/313  
:BLT:SWISS 25->362 ASPG1_ECOLI 0.0 94.7 %
:PROS 32->40|PS00144|ASN_GLN_ASE_1
:PROS 108->118|PS00917|ASN_GLN_ASE_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68717.1 GT:GENE ansA GT:PRODUCT L-asparaginase 1 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1376843..1377931) GB:FROM 1376843 GB:TO 1377931 GB:DIRECTION - GB:GENE ansA GB:PRODUCT L-asparaginase 1 GB:NOTE identified by match to protein family HMM PF00710; match to protein family HMM TIGR00519 GB:PROTEIN_ID ACF68717.1 GB:DB_XREF GI:194408498 GB:GENE:GENE ansA LENGTH 362 SQ:AASEQ MAASAHSRHPIIINTSFATRLNIIMQKKSIYVAYTGGTIGMQRSDKGYIPVSGHLQRQLALMPEFHRPEMPDFTIHEYAPLMDSSDMTPEDWQHIAADIKAHYDEYDGFVILHGTDTMAFTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLFRGNRTTKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPYGSGELIVHPITPQPIGVVTIYPGISAEVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELKEASSRGIVVVNLTQCMSGRVNMGGYATGNALAHAGVIGGADMTVEATLTKLHYLLSQGLDTQAIRSAMAQNLRGELTPDD GT:EXON 1|1-362:0| SW:ID ASPG1_ECOLI SW:DE RecName: Full=L-asparaginase 1; EC=3.5.1.1;AltName: Full=L-asparaginase I; Short=L-ASNase I;AltName: Full=L-asparagine amidohydrolase I; SW:GN Name=ansA; OrderedLocusNames=b1767, JW1756; SW:KW 3D-structure; Complete proteome; Cytoplasm; Hydrolase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 25->362|ASPG1_ECOLI|0.0|94.7|338/338| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| PROS 32->40|PS00144|ASN_GLN_ASE_1|PDOC00132| PROS 108->118|PS00917|ASN_GLN_ASE_2|PDOC00132| BL:PDB:NREP 1 BL:PDB:REP 26->361|2p2dC|0.0|94.6|331/331| RP:PDB:NREP 1 RP:PDB:REP 5->360|2d6fA|1e-60|27.1|351/424| RP:PFM:NREP 1 RP:PFM:REP 30->344|PF00710|2e-83|53.9|310/315|Asparaginase| HM:PFM:NREP 1 HM:PFM:REP 30->347|PF00710|1e-112|46.7|306/313|Asparaginase| GO:PFM:NREP 1 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF00710|IPR006034| RP:SCP:NREP 1 RP:SCP:REP 28->360|1zq1A2|2e-89|29.9|324/363|c.88.1.1| HM:SCP:REP 21->360|2d6fA2|3.8e-109|44.0|334/0|c.88.1.1|1/1|Glutaminase/Asparaginase| OP:NHOMO 930 OP:NHOMOORG 716 OP:PATTERN 11111111111111111111111111111111111111111111111111111122222121111111 ------11111---1------1111------1-----111----------1-----1------1-1-----1------11111-----3332-111---1211111-111------------------1-----------1---1------------111-----------------------111------11222222121122222113211221111111111111111111111111111111111111111111-111--111111111111111111111111111111111111111111111111-11111111-1111-------1-1-----11111--1-1---11-----1--111--1-1-------------1----------11111111111-11111-1-----1--1--------1------1-1-1-1-11111111------------------------------------------11---11111112111111212111111112222--11121-1121112121-----111111111---1------1-1-1-1-------------11111----21-1111111-11-------1--1--2211--111111222212111111111111--1----------21112112222222222-222232222222222222222121222333233333332322322222222--222222222222---1-----1111--1122221111-1111---1111111---2-22222221122221111222122212-12221111122111------------------------------------------------------------11-11------1- ----111-42-2111111-111111111111-111111111111111111124222111111-11111-11111111111111111-1-11111111111111112-1212111-21--1-11-11-11221-112-1--1111--1-1-1--311111---14-11211-1431-111E21111----1--2111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 357 STR:RPRED 98.6 SQ:SECSTR ####EEEcTTccccEEEcccccccccccEEEEEEcccccccEEcTTTccEEccccTTHHHHHHcGGGGGTcEEEccccccEccGGGccHHHHHHHHHHHHHHHTTccEEEEEccTTTHHHHHHHHHHHEEcccccEEEEcccccTTcTTcTHHHHHHHHHHHHHcccccEEEccccEEEEEGGGEEEcccccTTcEEEccccccEEEETTEEcccccccccTTcccEEcccccccEEEEEccTTccHHHHHHHHHTTccEEEEEEcTTTcccccGGGHHHHHHHHHTTccEEEEETTccccccTTccHHHHHHHHTTcEEcTTccHHHHHHHHHHHTTTcccHHHHHHHHHcccccccccc# DISOP:02AL 1-6,8-8,21-23,359-363| PSIPRED ccccccccccEEEEEcccccHHHHcccccEEEEEccccccEEEcccccccccccHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHHHccccccEEEEEEccEEEcccEEEEccccccccccccccccEEEEEccEEEEcccccccccccccccccccccEEEEEEcccccHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEccccccEEcccccccHHHHHccEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccc //