[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : aroK.1
DDBJ      :aroK         shikimate kinase
Swiss-Prot:AROL_SALNS   RecName: Full=Shikimate kinase 2;         Short=SK 2;         EC=2.7.1.71;

Homologs  Archaea  8/68 : Bacteria  648/915 : Eukaryota  81/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->168 1e6cA PDBj 3e-50 51.2 %
:RPS:PDB   7->168 3akyA PDBj 3e-13 23.5 %
:RPS:SCOP  5->168 1knqA  c.37.1.17 * 1e-15 16.7 %
:HMM:SCOP  2->169 1kagA_ c.37.1.2 * 1.8e-31 30.7 %
:RPS:PFM   12->164 PF01202 * SKI 2e-23 40.9 %
:HMM:PFM   11->168 PF01202 * SKI 3.7e-49 38.1 155/158  
:BLT:SWISS 1->181 AROL_SALNS e-102 100.0 %
:PROS 58->82|PS01128|SHIKIMATE_KINASE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67555.1 GT:GENE aroK.1 GT:PRODUCT shikimate kinase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 487980..488525 GB:FROM 487980 GB:TO 488525 GB:DIRECTION + GB:GENE aroK GB:PRODUCT shikimate kinase GB:NOTE identified by match to protein family HMM PF01202 GB:PROTEIN_ID ACF67555.1 GB:DB_XREF GI:194407336 GB:GENE:GENE aroK LENGTH 181 SQ:AASEQ MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMSVADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCAPVSTLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKTPAQVVSEIIAALPPSTQRLQGDVYT GT:EXON 1|1-181:0| SW:ID AROL_SALNS SW:DE RecName: Full=Shikimate kinase 2; Short=SK 2; EC=2.7.1.71; SW:GN Name=aroL; OrderedLocusNames=SNSL254_A0431; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->181|AROL_SALNS|e-102|100.0|181/181| GO:SWS:NREP 8 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 58->82|PS01128|SHIKIMATE_KINASE|PDOC00868| BL:PDB:NREP 1 BL:PDB:REP 1->168|1e6cA|3e-50|51.2|168/170| RP:PDB:NREP 1 RP:PDB:REP 7->168|3akyA|3e-13|23.5|162/218| RP:PFM:NREP 1 RP:PFM:REP 12->164|PF01202|2e-23|40.9|149/156|SKI| HM:PFM:NREP 1 HM:PFM:REP 11->168|PF01202|3.7e-49|38.1|155/158|SKI| GO:PFM:NREP 2 GO:PFM GO:0004765|"GO:shikimate kinase activity"|PF01202|IPR000623| GO:PFM GO:0005524|"GO:ATP binding"|PF01202|IPR000623| RP:SCP:NREP 1 RP:SCP:REP 5->168|1knqA|1e-15|16.7|156/171|c.37.1.17| HM:SCP:REP 2->169|1kagA_|1.8e-31|30.7|166/0|c.37.1.2|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 885 OP:NHOMOORG 737 OP:PATTERN -------------------------------------------21-22-1111--------------- 111---11---1--11111-1111111111111----1111---1---111-----1------1-1-11---111---2221-1111111111111--1-1111--11-1--------1-----11111111111-11111---2111111111111111111111111111111111111111111111-11-111111-111-111-------1111--1111111111111---------------11111----------1-----1--111111---111111111111111111-------------111---111-11111---1---1-12111----212-11221-111211111-1111-11-11-1111111111123-1122222------------22222211131-111111111111-111111111111111111111111111111--------------------------------11111111111111111111111111111112111211111111---1111211-1111111111111111221-2212212212222-212211121------111111-------1-1111111-11--111111121111111111111111111111111-112-111111122321222222222222-222222222222222222222222222122222222222222222222222212222222222221111111111111111111111111111111111111111111121111111111111-1111111111111111111111111111111111111111111-111--------------1---------------------------1-------111 ------1-----11-111------1-111-11111111111-1-----111111-----1111--111-2-11-111-111-11-111--3111-1-11111-111----------------------------1----------------------------1------------111-121112324-4211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 92.8 SQ:SECSTR GccEEEEEccTTccHHHHHHHHHHHHccEEEEHHHHHHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHcGGGGccEEEEcccccHHHHccEEEEEEccHHHHHHHHHcccccTTccGGGcccccTccHHHHHHHHHHHHHHTEEEEETTccHHHHHHHHHHHH############# DISOP:02AL 1-1,176-176| PSIPRED ccccEEEEccccccHHHHHHHHHHHHcccEEEHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHccccEEEccccHHccHHHHHHHHHccEEEEEEccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHHHHHHHHcccccc //