[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : arsC
DDBJ      :arsC         arsenate reductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  403/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->118 3f0iB PDBj 2e-33 58.9 %
:RPS:PDB   5->91 2e7pA PDBj 1e-06 11.6 %
:RPS:SCOP  4->119 1rw1A  c.47.1.12 * 1e-19 18.6 %
:HMM:SCOP  4->118 1j9bA_ c.47.1.12 * 3.8e-33 42.1 %
:RPS:PFM   8->118 PF03960 * ArsC 6e-25 51.8 %
:HMM:PFM   8->118 PF03960 * ArsC 9.6e-34 36.4 110/112  
:BLT:SWISS 1->119 YFGD_ECOLI 2e-54 83.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67464.1 GT:GENE arsC GT:PRODUCT arsenate reductase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2665997..2666356 GB:FROM 2665997 GB:TO 2666356 GB:DIRECTION + GB:GENE arsC GB:PRODUCT arsenate reductase GB:NOTE identified by match to protein family HMM PF03960; match to protein family HMM TIGR00014 GB:PROTEIN_ID ACF67464.1 GB:DB_XREF GI:194407245 GB:GENE:GENE arsC LENGTH 119 SQ:AASEQ MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSEEALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 1->119|YFGD_ECOLI|2e-54|83.2|119/119| BL:PDB:NREP 1 BL:PDB:REP 4->118|3f0iB|2e-33|58.9|112/114| RP:PDB:NREP 1 RP:PDB:REP 5->91|2e7pA|1e-06|11.6|86/107| RP:PFM:NREP 1 RP:PFM:REP 8->118|PF03960|6e-25|51.8|110/111|ArsC| HM:PFM:NREP 1 HM:PFM:REP 8->118|PF03960|9.6e-34|36.4|110/112|ArsC| RP:SCP:NREP 1 RP:SCP:REP 4->119|1rw1A|1e-19|18.6|113/114|c.47.1.12| HM:SCP:REP 4->118|1j9bA_|3.8e-33|42.1|114/138|c.47.1.12|1/1|Thioredoxin-like| OP:NHOMO 545 OP:NHOMOORG 408 OP:PATTERN -------------------------------------------------------------------- ----1-11111---111----1--11-----111111111-------------------------11111-----------------------------111111-1-------------------------------------------11------------2------------------------------------------------1-----------------------------------------------------------------1111-----------------1111111111111---------1----------------------------------------------------11112-----111112242111111111111112-24124221211-111111111111222211241-1--1133333333111-1111-------------------------------122-222131111111111155211111-12121212--211-1121311-2-221---1111111111111-1-1-----------------------1--1----1-------------------1---1--221111111111111111121121111311---11-1------12221212222222212-2222222222222222222332211112211121111111111222222222-311111111111---1-----111111111111-1111111-11221112--11121111111111111111112111111111111111111111112211111--2----111-----------------------------------------------------1-- --------------------------------------------------------------1----------------------------------------------------------------------------------------------------1---------1--------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 96.6 SQ:SECSTR ###cEEEEEcTTcHHHHHHHHHHHHHTcccEEEEGGGcTTHHHHHHHHHHHHcccccccEEEETTEEEEcHHHHHHHHHTTcHHHHHHHTTHHHTTccccETTEEEEcccGGGGGGGc# DISOP:02AL 1-1| PSIPRED cccEEEEEEccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccHHHHHHcccHHHHHcccccccccHHHHHHHHHHcccEEEccEEEEccEEEEEccHHHHHHHHc //