[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : artM
DDBJ      :artM         arginine ABC transporter, permease protein ArtM
Swiss-Prot:ARTM_SHIFL   RecName: Full=Arginine ABC transporter permease protein artM;

Homologs  Archaea  30/68 : Bacteria  660/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   84->153 3c7yA PDBj 4e-12 18.6 %
:RPS:SCOP  46->214 2r6gG1  f.58.1.1 * 3e-17 13.5 %
:HMM:PFM   31->214 PF00528 * BPD_transp_1 8.8e-16 19.0 174/185  
:BLT:SWISS 1->222 ARTM_SHIFL e-106 95.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68533.1 GT:GENE artM GT:PRODUCT arginine ABC transporter, permease protein ArtM GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1006179..1006847) GB:FROM 1006179 GB:TO 1006847 GB:DIRECTION - GB:GENE artM GB:PRODUCT arginine ABC transporter, permease protein ArtM GB:NOTE identified by match to protein family HMM PF00528; match to protein family HMM TIGR01726 GB:PROTEIN_ID ACF68533.1 GB:DB_XREF GI:194408314 GB:GENE:GENE artM LENGTH 222 SQ:AASEQ MLEYLPELLKGLHTSLTLTVASIAVALVLALVFTIILTLKTPFVVWLVRGYITLFTGTPLLVQIFLIYYGPGQFPTLQEYPLLWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCGALGMSKKDTLAILLPYAFKRALSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVVVFGAAGVIYLVVNGLLTLMMRLIERKALAFERRN GT:EXON 1|1-222:0| SW:ID ARTM_SHIFL SW:DE RecName: Full=Arginine ABC transporter permease protein artM; SW:GN Name=artM; OrderedLocusNames=SF0815, S0857; SW:KW Amino-acid transport; Cell inner membrane; Cell membrane;Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->222|ARTM_SHIFL|e-106|95.0|222/222| GO:SWS:NREP 6 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 4 TM:REGION 15->37| TM:REGION 47->69| TM:REGION 85->107| TM:REGION 186->208| SEG 16->39|ltltvasiavalvlalvftiiltl| RP:PDB:NREP 1 RP:PDB:REP 84->153|3c7yA|4e-12|18.6|70/164| HM:PFM:NREP 1 HM:PFM:REP 31->214|PF00528|8.8e-16|19.0|174/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 46->214|2r6gG1|3e-17|13.5|163/284|f.58.1.1| OP:NHOMO 3453 OP:NHOMOORG 694 OP:PATTERN 11--12----------1-1111114--11-2211----1122--2212--1-1----2------2--- ----41112221-12------3---9------4333139612113-41211-536123--1-1-46562713---21121321---------------------------11111111111111-----1--2------33111---1121111111-------1--112---1---------1341111--252333347543453345233963452336543555553952222222222222222222353448A564355544A83646943337777566388666556666666666566666666557876777813454564545523224442333212212233178-4132-1111111161--111122222--F561-1111112364336456N-22A229168F-1RHHGGLLMJSHJD4---12E33222361111111121311-14----------111111111111111--1-4--1--2A86AIHHIIFB9BBCBBGPDCDD9DDDR6773--54765532768BGK124----833322222---11--1E-696A46999842-23-3----------5-3321223323111222222-12----778-3-----5-1111--11111111-11-2---1--------89JH79B8888886888-88A8888888888788779DHCGE5549897999899999989F88788883-9BBBBBAABBBB--4-111111111--44A44443433323333222222-43443-CCCDFJHO8CFAC5IGH----------4447777778876611---------------2----------------3-------------------------122-113111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------2-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 70 STR:RPRED 31.5 SQ:SECSTR ###################################################################################HHHccHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHTTcHHHHHHHHccHHHcHHHHHHHHHHHHcGGGTT##################################################################### DISOP:02AL 218-223| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //