[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : artQ
DDBJ      :artQ         arginine ABC transporter, permease protein ArtQ
Swiss-Prot:ARTQ_SHIFL   RecName: Full=Arginine ABC transporter permease protein artQ;

Homologs  Archaea  30/68 : Bacteria  675/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   130->165 3dhwA PDBj 3e-07 37.5 %
:RPS:SCOP  6->232 2r6gG1  f.58.1.1 * 8e-18 14.5 %
:HMM:PFM   25->230 PF00528 * BPD_transp_1 2e-18 21.5 177/185  
:BLT:SWISS 1->237 ARTQ_SHIFL e-121 94.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70395.1 GT:GENE artQ GT:PRODUCT arginine ABC transporter, permease protein ArtQ GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1006847..1007563) GB:FROM 1006847 GB:TO 1007563 GB:DIRECTION - GB:GENE artQ GB:PRODUCT arginine ABC transporter, permease protein ArtQ GB:NOTE identified by match to protein family HMM PF00528; match to protein family HMM TIGR01726 GB:PROTEIN_ID ACF70395.1 GB:DB_XREF GI:194410176 GB:GENE:GENE artQ LENGTH 238 SQ:AASEQ MNEFFPLASAAGMTVGLAVCALIIGLALAMFFAVWESVKWRPIAWIGSALVTILRGLPEILVVLFIYFGSSQLLLTLSDGFTLHLGFTQIPVQMEIENFDVSPFLCGVIALSLLYAAYASQTLRGALKAVPSGQWESGQALGLSKTAIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFNWYIIAAAIYLVITLISQYILKRIDLRATRFERRPD GT:EXON 1|1-238:0| SW:ID ARTQ_SHIFL SW:DE RecName: Full=Arginine ABC transporter permease protein artQ; SW:GN Name=artQ; OrderedLocusNames=SF0816, S0858; SW:KW Amino-acid transport; Cell inner membrane; Cell membrane;Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->237|ARTQ_SHIFL|e-121|94.5|237/238| GO:SWS:NREP 6 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 4 TM:REGION 10->32| TM:REGION 50->72| TM:REGION 98->120| TM:REGION 201->223| SEG 110->120|alsllyaayas| RP:PDB:NREP 1 RP:PDB:REP 130->165|3dhwA|3e-07|37.5|32/203| HM:PFM:NREP 1 HM:PFM:REP 25->230|PF00528|2e-18|21.5|177/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 6->232|2r6gG1|8e-18|14.5|207/284|f.58.1.1| OP:NHOMO 3680 OP:NHOMOORG 708 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2222--1-1----2------1--- ----42122223114------4---A------533313A712-14153311-536125--21114657173433332221211---------------------------11111111111111-----1--4------44111--12222233312-------1--3322--112---112-134------1634444486546544562339844532254424444429522222222222222222224534478555456655773645A43337777455499777666777765555555555555647544777713545564545523224442333112212233167-4132-1111111161--11112222221E46112111112364336456P-22A228178G12WJJMMQPPNaHJC5---13I23332381111111122311-24------------1111111111111----3--2--2A869MIIJKIB7AAABBIQB9AA8BFCV5662-19893454375CCHM223----933322222---12-11D-897C55899942-23-3----------3-3331444443111111111-13----78A-3-----8-1111--11111111-11-3---1--------9AHJ79A9989997997-99B9999999999899889EJDLK6669887999999999989F89899993-CAAAAAB9AAAA--5-222221111--6AA44443433323333144444-33453-ECCEFMFM8FGCD5IHI----------4448777778876611---------------2----------------3312----------------------122-114111--1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 32 STR:RPRED 13.4 SQ:SECSTR #################################################################################################################################ccTTTTTHHHHHTccTHHHHHHTTHHH####HHHHH######################################################################### DISOP:02AL 233-239| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //