[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : asnS
DDBJ      :asnS         asparagine tRNA synthetase
Swiss-Prot:SYN_SALTY    RecName: Full=Asparaginyl-tRNA synthetase;         EC=6.1.1.22;AltName: Full=Asparagine--tRNA ligase;         Short=AsnRS;

Homologs  Archaea  68/68 : Bacteria  575/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
b.40.4d.104.1
:466 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->461 1x54A PDBj 2e-64 39.9 %
:RPS:PDB   18->464 1asyA PDBj 7e-61 22.4 %
:RPS:SCOP  1->99 1c0aA1  b.40.4.1 * 2e-17 24.5 %
:RPS:SCOP  130->461 1nnhA  d.104.1.1 * 1e-76 29.9 %
:HMM:SCOP  1->104 1c0aA1 b.40.4.1 * 3.7e-20 30.3 %
:HMM:SCOP  94->466 1eovA2 d.104.1.1 * 9.6e-97 33.3 %
:RPS:PFM   126->461 PF00152 * tRNA-synt_2 1e-56 44.2 %
:HMM:PFM   120->461 PF00152 * tRNA-synt_2 4e-73 31.3 297/323  
:HMM:PFM   20->99 PF01336 * tRNA_anti 2.4e-15 31.1 74/76  
:BLT:SWISS 1->466 SYN_SALTY 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68588.1 GT:GENE asnS GT:PRODUCT asparagine tRNA synthetase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1095848..1097248) GB:FROM 1095848 GB:TO 1097248 GB:DIRECTION - GB:GENE asnS GB:PRODUCT asparagine tRNA synthetase GB:NOTE identified by match to protein family HMM PF00152; match to protein family HMM PF01336; match to protein family HMM TIGR00457 GB:PROTEIN_ID ACF68588.1 GB:DB_XREF GI:194408369 GB:GENE:GENE asnS LENGTH 466 SQ:AASEQ MSVVPVADVLQGRVAVDQEVTVRGWVRTRRDSKAGISFLAVYDGSCFDPVQAVINNSLPNYNEEVLHLTTGCSVVVTGKVVASPGQGQSFEIQATKVEVAGWVEDPDTYPMAAKRHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFDEQGFFWVSTPLITASDTEGAGEMFRVSTLDLENLPRNDQGRVDFDKDFFGKESFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFADLEDNARLAEAMLKYVFNAVLEERADDMKFFAERVDKDAIARLERFVSTDFAQVDYTDAVAILERCGKTFENPVFWGVDLSSEHERYLAEEHFKAPVVVKNYPKEIKAFYMRLNEDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDARMAEMGLNKEDYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTPRNASF GT:EXON 1|1-466:0| SW:ID SYN_SALTY SW:DE RecName: Full=Asparaginyl-tRNA synthetase; EC=6.1.1.22;AltName: Full=Asparagine--tRNA ligase; Short=AsnRS; SW:GN Name=asnS; Synonyms=tss; OrderedLocusNames=STM1000; SW:KW 3D-structure; Aminoacyl-tRNA synthetase; ATP-binding;Complete proteome; Cytoplasm; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->466|SYN_SALTY|0.0|100.0|466/466| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 18->461|1x54A|2e-64|39.9|409/434| RP:PDB:NREP 1 RP:PDB:REP 18->464|1asyA|7e-61|22.4|424/490| RP:PFM:NREP 1 RP:PFM:REP 126->461|PF00152|1e-56|44.2|312/337|tRNA-synt_2| HM:PFM:NREP 2 HM:PFM:REP 120->461|PF00152|4e-73|31.3|297/323|tRNA-synt_2| HM:PFM:REP 20->99|PF01336|2.4e-15|31.1|74/76|tRNA_anti| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00152|IPR004364| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00152|IPR004364| GO:PFM GO:0005524|"GO:ATP binding"|PF00152|IPR004364| GO:PFM GO:0005737|"GO:cytoplasm"|PF00152|IPR004364| GO:PFM GO:0006412|"GO:translation"|PF00152|IPR004364| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00152|IPR004364| RP:SCP:NREP 2 RP:SCP:REP 1->99|1c0aA1|2e-17|24.5|94/106|b.40.4.1| RP:SCP:REP 130->461|1nnhA|1e-76|29.9|274/293|d.104.1.1| HM:SCP:REP 1->104|1c0aA1|3.7e-20|30.3|99/0|b.40.4.1|1/1|Nucleic acid-binding proteins| HM:SCP:REP 94->466|1eovA2|9.6e-97|33.3|348/0|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 1786 OP:NHOMOORG 839 OP:PATTERN 11313111111111114333333111111111111111111111112111111133233333333122 111-2-1--------------------------------11-11-1---1111--1-111--1---------------1--2------1111111111111111111111--------------1--11111-1-111111---1-1111221--11------111-1111---1111-11-132122111213222222222232223112222222222-1111222121-33333333333333222233111221211112211111321122221111111111111111111112211121121111111111111112232222222222111221232321211-21222211-112-121-1212-1---------------------------------------------11--------------11----------------------------1----------------------1111-----------------------------------111111-----111---------------1111111-----111212111111111122211121111111112------------------------1--11122-1312121111111111111111121----1-11111133222124444445444-4444434444444444443444123333333333333333333333333343121111111111111132222222221-1-1111111211112212----------1-1111-1111----1---111111111-1111111111111133222222222222----1111111111111111212111-11111212221111111113412321222-22 3422322-83323334454444444444444344444444344333445544454444444433333323433333313333333343-47343434443334334235353736463232333452424J3-3343222533433313432354333334B34331334553433223S4332255A64834463333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 464 STR:RPRED 99.6 SQ:SECSTR ##EEcGGGcTTEEEHTTcccEEEEEEEEEEEEETTEEEEEEEccccEEEEEEEccTTccccHHHHHTccTTcEEEEEEEEEEcccccccEEEEEEEEEEEEcccccccccHHHccccHHHHHHTHHHHTTcTTHHHHHHHHHHHHHHHHHHHHHTTcEEcccccEEccccTTTTccccEEEEETTEEEEETTcTTcEEcccTTcccEEccccHHHHHHHHHTTcEEEEEEEEccccccccccccccEEEEEEEEEcccTHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHTTccEHHccccccccccccEEEEHHHHHHHHHHTTccccccccccHHHHHHHHHHHHHHHcccEEEEEcccTTcccTTcccccccTTccccEEEEETTEEEEEEEEEcccHHHHHHHHHHTTccTTcHHHHHHTTTTccccEEEEEEEHHHHHHHHHTcccGGGGccccccccccEE DISOP:02AL 1-1,464-467| PSIPRED ccEEEHHHHHccccccccEEEEEEEEEEEccccccEEEEEEEccccEEEEEEEEccccHHHHHHHHccccccEEEEEEEEEEccccccEEEEEEEEEEEEcccccccccccccHHccHHHHHHcccHHcccHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccEEEcccccccccEEEEccccccccccccccccccccHHccccEEEcccHHHHHHHHHHccccEEEEEEEEEcccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccEEEEEEEEEccEEEEEEHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEEcHHHHHHHHHccccHHEEEccccccccccc //