[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : aspC
DDBJ      :aspC         aspartate transaminase
Swiss-Prot:AAT_SALTY    RecName: Full=Aspartate aminotransferase;         Short=AspAT;         EC=2.6.1.1;AltName: Full=Transaminase A;

Homologs  Archaea  0/68 : Bacteria  304/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:396 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->396 1arsA PDBj 0.0 96.0 %
:RPS:PDB   1->396 1asfA PDBj 2e-65 95.7 %
:RPS:SCOP  1->396 1aamA  c.67.1.1 * 6e-70 95.7 %
:HMM:SCOP  1->396 2cstA_ c.67.1.1 * 9.9e-120 39.1 %
:RPS:PFM   70->333 PF00155 * Aminotran_1_2 7e-15 29.8 %
:HMM:PFM   28->392 PF00155 * Aminotran_1_2 1.1e-97 36.2 343/363  
:BLT:SWISS 1->396 AAT_SALTY 0.0 100.0 %
:PROS 243->256|PS00105|AA_TRANSFER_CLASS_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69264.1 GT:GENE aspC GT:PRODUCT aspartate transaminase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1092775..1093965) GB:FROM 1092775 GB:TO 1093965 GB:DIRECTION - GB:GENE aspC GB:PRODUCT aspartate transaminase GB:NOTE identified by match to protein family HMM PF00155 GB:PROTEIN_ID ACF69264.1 GB:DB_XREF GI:194409045 GB:GENE:GENE aspC LENGTH 396 SQ:AASEQ MFENITAAPADPILGLADLFRADDRPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFARCTQELLFGKGSALINDKRARTAQTPGGTGALRIAADFLAKNTPVKRVWVSNPSWPNHKSVFNAAGLEVREYAYYDAENHTLDFEALQASLSEAQAGDVVLFHGCCHNPTGIDPTLEQWQVLAELSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAALHKELIVASSYSKNFGLYNERVGACTLVAADAETVDRAFSQMKSAIRANYSNPPAHGASIVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKDQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL GT:EXON 1|1-396:0| SW:ID AAT_SALTY SW:DE RecName: Full=Aspartate aminotransferase; Short=AspAT; EC=2.6.1.1;AltName: Full=Transaminase A; SW:GN Name=aspC; OrderedLocusNames=STM0998; SW:KW Aminotransferase; Complete proteome; Cytoplasm; Pyridoxal phosphate;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->396|AAT_SALTY|0.0|100.0|396/396| GO:SWS:NREP 3 GO:SWS GO:0008483|"GO:transaminase activity"|Aminotransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 243->256|PS00105|AA_TRANSFER_CLASS_1|PDOC00098| BL:PDB:NREP 1 BL:PDB:REP 1->396|1arsA|0.0|96.0|396/396| RP:PDB:NREP 1 RP:PDB:REP 1->396|1asfA|2e-65|95.7|396/396| RP:PFM:NREP 1 RP:PFM:REP 70->333|PF00155|7e-15|29.8|245/341|Aminotran_1_2| HM:PFM:NREP 1 HM:PFM:REP 28->392|PF00155|1.1e-97|36.2|343/363|Aminotran_1_2| GO:PFM:NREP 3 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00155|IPR004839| GO:PFM GO:0016769|"GO:transferase activity, transferring nitrogenous groups"|PF00155|IPR004839| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00155|IPR004839| RP:SCP:NREP 1 RP:SCP:REP 1->396|1aamA|6e-70|95.7|396/396|c.67.1.1| HM:SCP:REP 1->396|2cstA_|9.9e-120|39.1|396/411|c.67.1.1|1/1|PLP-dependent transferases| OP:NHOMO 1100 OP:NHOMOORG 497 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------111111111111111----------------------------------------------------------------------------------------------------------------1----------1------------------------------------------------------------------------------------------1---------1---------------------1---1---------1--12---------------------------1-1-----111121111--11-1111111111----------------------------------------------113-1121213222222222122323333-322222321111122111211111111----2-2222222---211----1------------------------------------------------------2221-12-11123222222222222222221------------22222222222222222-22222222222222222223332222222222222222222223222222221222222222222111------------11211111111111111111111111111122223222222222222----------2222222222222211111111111111--------------------1-------------------------------------- 11--222-42212222232445466653333333333443343333322364682332232223422223323232222223333322-22222223333242232-24234C34633233332352635N3-376223231343233233223322323452332352223622132191112334B82732221114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 396 STR:RPRED 100.0 SQ:SECSTR ccTTTccccccHHHHHHHHHHTTcccccccccccccccTTccccccHHHHHHHHHHHHHccccccccTTccHHHHHHHHHHHcccccTTTTTTcEEEEEEcHHHHHHHHHHHHHHHHccccEEEEcccccTHHHHHHHHHTcEEEEcccEETTTTEEccHHHHTTGGGccTTcEEEEEccccTTTcccccHHHHHHHHHHHHTTccEEEEEEccTTccccHHHHTHHHHHHTTTccEEEEEEEcccccccTTTccEEEEEEEccHHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccGGGccccccEEEccccHHHHHHHHTTccccccTTTEEEGGGccTTTHHHHHHHHHHcc PSIPRED ccccccccccccHHHHHHHHHcccccccEEccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEccHHHHHcccccccHHHHHHHHccccEEEEEccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEccccHHHHHHHHHHccEEEccccEEEEEEccHHHHHHHHHHHHHHc //