[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : asrA
DDBJ      :asrA         sulfite reductase, subunit A
Swiss-Prot:ASRA_SALTY   RecName: Full=Anaerobic sulfite reductase subunit A;AltName: Full=Anaerobic sulfite reductase iron-sulfur subunit;

Homologs  Archaea  8/68 : Bacteria  91/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.1.2
:347 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  312->346 1e7pB1  a.1.2.1 * 3e-04 22.6 %
:HMM:SCOP  186->341 1kf6B1 a.1.2.1 * 3.2e-12 19.5 %
:HMM:PFM   228->242 PF00037 * Fer4 2.4e-05 46.7 15/24  
:HMM:PFM   310->324 PF00037 * Fer4 3.7e-05 46.7 15/24  
:HMM:PFM   208->221 PF02173 * pKID 0.001 57.1 14/41  
:BLT:SWISS 1->347 ASRA_SALTY 0.0 99.1 %
:PROS 230->241|PS00198|4FE4S_FER_1
:PROS 312->323|PS00198|4FE4S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66411.1 GT:GENE asrA GT:PRODUCT sulfite reductase, subunit A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2743131..2744174 GB:FROM 2743131 GB:TO 2744174 GB:DIRECTION + GB:GENE asrA GB:PRODUCT sulfite reductase, subunit A GB:NOTE identified by match to protein family HMM TIGR02910 GB:PROTEIN_ID ACF66411.1 GB:DB_XREF GI:194406192 GB:GENE:GENE asrA LENGTH 347 SQ:AASEQ MAIKITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNIIYQRISGWRELIWHEKSHMSPNTIIAPITETLFYFDKDTIQIAETDTSPIIIFARACDINAMSRLDYMYLSNGNNSDYSYQLLREHIRFVLIECEESFENCFCVSMGTNKTDCYSAAMRFSDEGALVSIRDPFIEAAIQGLGQEADYTPSFVSENRETVVTPDSVCRDPQKIRDILTRHPLWDAYDSRCISCGRCTTGCPTCTCYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGGHGFREKPGERLRYRALHKVNDYKARNGIEHMCVGCGRCDDRCPQYIKFSLIINKMTAAVRQALAEEA GT:EXON 1|1-347:0| SW:ID ASRA_SALTY SW:DE RecName: Full=Anaerobic sulfite reductase subunit A;AltName: Full=Anaerobic sulfite reductase iron-sulfur subunit; SW:GN Name=asrA; OrderedLocusNames=STM2548; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Electron transport; Iron;Iron-sulfur; Metal-binding; Repeat; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->347|ASRA_SALTY|0.0|99.1|347/347| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 230->241|PS00198|4FE4S_FER_1|PDOC00176| PROS 312->323|PS00198|4FE4S_FER_1|PDOC00176| SEG 233->245|cgrcttgcptctc| HM:PFM:NREP 3 HM:PFM:REP 228->242|PF00037|2.4e-05|46.7|15/24|Fer4| HM:PFM:REP 310->324|PF00037|3.7e-05|46.7|15/24|Fer4| HM:PFM:REP 208->221|PF02173|0.001|57.1|14/41|pKID| RP:SCP:NREP 1 RP:SCP:REP 312->346|1e7pB1|3e-04|22.6|31/133|a.1.2.1| HM:SCP:REP 186->341|1kf6B1|3.2e-12|19.5|128/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 121 OP:NHOMOORG 99 OP:PATTERN -----------------------------1------------------------12--122-1-1--- ------------------------1-------------------------------------------------------11---11-----1--------------------------------221211--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111112-1--1221-1------11--3211-11211----1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---1211111--2221113-2-------1-------------------------111----------------------------------------------3----------------1-----------------------11-1111111111111-------------------------------1111------------------------------1------------------1---------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,340-348| PSIPRED ccEEccHHHHHHHHHHHHHccEEEEEEEEccccccccccccEEcccccHHHHHcccccccccHHcccccccEEEEEEcccccccccccccEEEEEEHHHHHHHHHHHHHHHcccccccHHHHHHHccEEEEEEEEccccccccEEcccccccccccHHHEEcccEEEEEEccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHccccHHcccccEEEEEEEEEEEccccccEEEcccccccccccccccccccccccccccEEEEEEEEEccccHHHccccccccccccHHHHccccccHHHHHHHHHHHHHHHHcccc //