[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : asrB
DDBJ      :asrB         sulfite reductase, subunit B
Swiss-Prot:ASRB_SALTY   RecName: Full=Anaerobic sulfite reductase subunit B;

Homologs  Archaea  32/68 : Bacteria  152/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1
:272 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->262 1ep1B PDBj 1e-09 25.6 %
:RPS:PDB   16->241 2bmwA PDBj 3e-24 19.5 %
:RPS:SCOP  19->103 1qfjA1  b.43.4.2 * 5e-13 17.1 %
:RPS:SCOP  99->264 1ep1B2  c.25.1.3 * 5e-22 21.8 %
:HMM:SCOP  13->103 1ep3B1 b.43.4.2 * 9.7e-18 30.8 %
:HMM:SCOP  99->269 1ep3B2 c.25.1.3 * 4.3e-30 34.9 %
:RPS:PFM   20->101 PF00970 * FAD_binding_6 2e-06 40.2 %
:RPS:PFM   115->213 PF00175 * NAD_binding_1 2e-06 28.6 %
:RPS:PFM   235->263 PF10418 * DHODB_Fe-S_bind 3e-06 58.6 %
:HMM:PFM   116->217 PF00175 * NAD_binding_1 1.2e-21 25.7 101/109  
:HMM:PFM   235->265 PF10418 * DHODB_Fe-S_bind 5.9e-15 51.6 31/40  
:HMM:PFM   33->101 PF00970 * FAD_binding_6 1.1e-08 35.3 68/99  
:HMM:PFM   221->232 PF11455 * DUF3018 0.00095 58.3 12/65  
:BLT:SWISS 1->272 ASRB_SALTY e-165 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66354.1 GT:GENE asrB GT:PRODUCT sulfite reductase, subunit B GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2744178..2744996 GB:FROM 2744178 GB:TO 2744996 GB:DIRECTION + GB:GENE asrB GB:PRODUCT sulfite reductase, subunit B GB:NOTE identified by match to protein family HMM PF00175; match to protein family HMM PF00970; match to protein family HMM TIGR02911 GB:PROTEIN_ID ACF66354.1 GB:DB_XREF GI:194406135 GB:GENE:GENE asrB LENGTH 272 SQ:AASEQ MSHCSCHDKPQHSLLPAAYRILSITRHTPLEWNFRVAVDFPAHWGQFVEVSLPRVGEAPISVSDYGDGWIDLLIRNVGKVTSALFTLKEGDNVWLRGCYGNGYPVDTLRHKPLLVVAGGTGVAPVKGLMRYFVENPQEIGQLDMILGYKNRDCVLYKEEMATWRGKHNLVLTLDEGEADDRYQIGRVTDRLADMTLSDIDTMQAIVVGPPIMITFTVKMLLQKGLKPEQIWVDYERRMACSVGKCGHCRMGEVYVCTDGPIFNYAVAQRFAD GT:EXON 1|1-272:0| SW:ID ASRB_SALTY SW:DE RecName: Full=Anaerobic sulfite reductase subunit B; SW:GN Name=asrB; OrderedLocusNames=STM2549; SW:KW 2Fe-2S; Complete proteome; Cytoplasm; Electron transport; FAD;Flavoprotein; Iron; Iron-sulfur; Metal-binding; NAD; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->272|ASRB_SALTY|e-165|100.0|272/272| GO:SWS:NREP 6 GO:SWS GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|2Fe-2S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 45->262|1ep1B|1e-09|25.6|203/261| RP:PDB:NREP 1 RP:PDB:REP 16->241|2bmwA|3e-24|19.5|226/295| RP:PFM:NREP 3 RP:PFM:REP 20->101|PF00970|2e-06|40.2|82/99|FAD_binding_6| RP:PFM:REP 115->213|PF00175|2e-06|28.6|98/107|NAD_binding_1| RP:PFM:REP 235->263|PF10418|3e-06|58.6|29/38|DHODB_Fe-S_bind| HM:PFM:NREP 4 HM:PFM:REP 116->217|PF00175|1.2e-21|25.7|101/109|NAD_binding_1| HM:PFM:REP 235->265|PF10418|5.9e-15|51.6|31/40|DHODB_Fe-S_bind| HM:PFM:REP 33->101|PF00970|1.1e-08|35.3|68/99|FAD_binding_6| HM:PFM:REP 221->232|PF11455|0.00095|58.3|12/65|DUF3018| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 2 RP:SCP:REP 19->103|1qfjA1|5e-13|17.1|82/91|b.43.4.2| RP:SCP:REP 99->264|1ep1B2|5e-22|21.8|147/160|c.25.1.3| HM:SCP:REP 13->103|1ep3B1|9.7e-18|30.8|91/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 99->269|1ep3B2|4.3e-30|34.9|152/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 306 OP:NHOMOORG 205 OP:PATTERN --1--------------------1-----1--1---111111--11122-211132212331121-11 ------------------------11-------111-11-1-1-----------------------------------1-22---11---1-2111-----------------------------22222111211-----111-----1----------------------------------------1-----------------1--------------------------------------------1---------------------------------11----------------------------------1--2444434444452311344213-11-1111115211-21222--1-1-2----------1-------1--------------2-------------------1------------------------------------------------------------------------------------------------------------11-------------1-------------------1122312131111-2221224-2--1--111-------------------------111-----------------------------------1---------------------------1---------------1-1-----1111111111111111-------------------------------1111------------------------------1------------------1---------------------------------------1111------------2--------------------1-------1----1---2-- ------------------------------------------------1----------11-----1------1-111-1----1--------------------2---------1-------1-----------1----------1-----------------------11-----------1--1-11--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 96.3 SQ:SECSTR HHHHHHHTTcccTcccEEEEEEEEEEcccTTccccETccccccTTcEEEEEcccccTTEEEccTTcccEEEEEEEccEEccHHHHTccTTcEEEEEEEEcccccccccTTcEEEEEEEGGGHHHHHHHHHHHHcHHHHcccEEEEEEEccGGGcTTHHHHHHHTTTEEEEEEETTTcccTTcccccHHHHHHHHHHHTcTTEEEEEEEcTTHHHHHHHHHHHHHHTTTccHHHHHHHHHHTcccccTTTccEEETTTTccEE########## DISOP:02AL 1-8| PSIPRED ccccccccccccEEccccEEEEEEEEccccEEEEEEccccccccccEEEEEEccccEEEEEEccccccEEEEEEEEcccHHHHHHHcccccEEEEEEcccccEEccccccccEEEEEccHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHccHHHHHHHHHHccEEEEEcccccccccccccHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHccccHHHEEEEcHHHccccccEEcccEEccEEEcccccEEcHHHHHcccc //