[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : asrC
DDBJ      :asrC         sulfite reductase, subunit C
Swiss-Prot:ASRC_SALTY   RecName: Full=Anaerobic sulfite reductase subunit C;         EC=1.8.1.-;

Homologs  Archaea  17/68 : Bacteria  124/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
d.134.1d.58.36
:337 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->187 2akjA PDBj 1e-11 30.7 %
:BLT:PDB   178->224 2o01C PDBj 7e-07 47.8 %
:RPS:PDB   21->231 2akjA PDBj 6e-21 15.8 %
:RPS:SCOP  26->82 1zj8A2  d.58.36.1 * 5e-14 24.6 %
:RPS:SCOP  110->267 2v4jA3  d.134.1.1 * 8e-13 21.5 %
:HMM:SCOP  26->84 1aopA1 d.58.36.1 * 3.7e-12 42.4 %
:HMM:SCOP  110->309 1aopA4 d.134.1.1 * 6.1e-21 35.6 %
:RPS:PFM   27->81 PF03460 * NIR_SIR_ferr 6e-09 41.8 %
:RPS:PFM   110->179 PF01077 * NIR_SIR 2e-09 45.7 %
:HMM:PFM   110->303 PF01077 * NIR_SIR 3.4e-25 29.9 134/157  
:HMM:PFM   23->82 PF03460 * NIR_SIR_ferr 9.7e-18 40.0 60/69  
:BLT:SWISS 1->337 ASRC_SALTY 0.0 100.0 %
:PROS 212->223|PS00198|4FE4S_FER_1
:PROS 151->167|PS00365|NIR_SIR
:REPEAT 2|180->190|212->222

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67969.1 GT:GENE asrC GT:PRODUCT sulfite reductase, subunit C GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2745007..2746020 GB:FROM 2745007 GB:TO 2746020 GB:DIRECTION + GB:GENE asrC GB:PRODUCT sulfite reductase, subunit C GB:NOTE identified by match to protein family HMM PF00037; match to protein family HMM PF01077; match to protein family HMM PF03460; match to protein family HMM TIGR02912 GB:PROTEIN_ID ACF67969.1 GB:DB_XREF GI:194407750 GB:GENE:GENE asrC LENGTH 337 SQ:AASEQ MSIDIDIIKARAKNEYRLSKVRGEAMISVRIPGGILPAHLLTVARDIAETWGNGQIHLTTRQKLAMPGIRYEDIDNVNAALEPFLREIEIELCDVQVEDTKAGYLAIGGRNIVACQGNRICQKANTDTTGLSRRLEKLVYPSPYHLKTVIVGCPNDCAKASMADLGIIGVAKMRFTADRCIGCGACVKACSHHAVGCLALKNGKAVKEESACIGCGECVLACPTLAWQRKPDQLWQVRLGGRTSKKTPRVGKLFLNWVTEDVIKQVIVNLYEFEKEMLGGKPIYLHMGHLIDKGGYLRFKERVLRGVQLNPEAMVAERIYWAEDESVARMHLKPAGH GT:EXON 1|1-337:0| SW:ID ASRC_SALTY SW:DE RecName: Full=Anaerobic sulfite reductase subunit C; EC=1.8.1.-; SW:GN Name=asrC; OrderedLocusNames=STM2550; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Electron transport; Heme; Iron;Iron-sulfur; Metal-binding; NAD; Oxidoreductase; Repeat; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->337|ASRC_SALTY|0.0|100.0|337/337| GO:SWS:NREP 8 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 212->223|PS00198|4FE4S_FER_1|PDOC00176| PROS 151->167|PS00365|NIR_SIR|PDOC00314| NREPEAT 1 REPEAT 2|180->190|212->222| BL:PDB:NREP 2 BL:PDB:REP 20->187|2akjA|1e-11|30.7|150/535| BL:PDB:REP 178->224|2o01C|7e-07|47.8|46/80| RP:PDB:NREP 1 RP:PDB:REP 21->231|2akjA|6e-21|15.8|190/535| RP:PFM:NREP 2 RP:PFM:REP 27->81|PF03460|6e-09|41.8|55/67|NIR_SIR_ferr| RP:PFM:REP 110->179|PF01077|2e-09|45.7|70/153|NIR_SIR| HM:PFM:NREP 2 HM:PFM:REP 110->303|PF01077|3.4e-25|29.9|134/157|NIR_SIR| HM:PFM:REP 23->82|PF03460|9.7e-18|40.0|60/69|NIR_SIR_ferr| GO:PFM:NREP 6 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF03460|IPR005117| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03460|IPR005117| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01077|IPR006067| GO:PFM GO:0020037|"GO:heme binding"|PF01077|IPR006067| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF01077|IPR006067| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01077|IPR006067| RP:SCP:NREP 2 RP:SCP:REP 26->82|1zj8A2|5e-14|24.6|57/152|d.58.36.1| RP:SCP:REP 110->267|2v4jA3|8e-13|21.5|144/189|d.134.1.1| HM:SCP:REP 26->84|1aopA1|3.7e-12|42.4|59/0|d.58.36.1|1/1|Sulfite reductase, domains 1 and 3| HM:SCP:REP 110->309|1aopA4|6.1e-21|35.6|135/145|d.134.1.1|1/1|Sulfite reductase hemoprotein (SiRHP), domains 2 and 4| OP:NHOMO 214 OP:NHOMOORG 151 OP:PATTERN ---------------------------------112211----24121135341-------------- ---------------------1----------1---------------------------------------------------------------------------------------------------1-------------111-11-------1---1--------------------------------------1---1--------1-1--------------1------------------------------------------------------------------------------------------1-1152222222223-2112221221---11--33122---1411-1--1---1111----------111-------------------------11--111111111111-1-1-111----1--------------11---------------------------------111-----1-----------------------------------1-------1---1-------------------1111111--1----121-3321-------11---------------------------1---------------------------------------------------------------1-----------------------1111111111111111-------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6111--122----11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 273 STR:RPRED 81.0 SQ:SECSTR ###################cHTTcEEEEcccGGGEEEHHHHHHHHHHHHTTGGccEEEcTTccEEEEEEcGGGHHHHHHHHHHHHHHTTTTccccccHHHTTTcccTTcccccccTTTTTcTTcccccHHHHHHHHHHHTTTcccccEEEcccTTcTTcGGGccEEEEEEEccccEEEEEEEccEEEccEEEEEEEEEEGGGHHHHHHHcHHHHHHHHcccccGGGccHHHTccHHHHEccccccccccccEEEEEEEEccHHHHHHHHccTTccHHHcHHHHHHHHTGGcc############################################# DISOP:02AL 1-1,3-3,334-338| PSIPRED ccccccHHHHHHHcccccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEccccEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEcccccccHHHccccHHHcccccccccHHHcccccEEEEccccccccccccccEEEEcHHHccccccHHHcccHHHcccccccEEEEEEEcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHHHccccccHHHcccccccccccHHHccccccccc //