[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : bioC
DDBJ      :bioC         biotin biosynthesis protein BioC
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  364/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->140 3bkwB PDBj 3e-08 32.6 %
:RPS:PDB   11->176 3cggB PDBj 9e-21 15.1 %
:RPS:SCOP  44->213 2avnA1  c.66.1.41 * 9e-21 25.8 %
:HMM:SCOP  9->177 1wznA1 c.66.1.43 * 4.8e-38 31.1 %
:RPS:PFM   47->134 PF08241 * Methyltransf_11 3e-14 40.9 %
:HMM:PFM   47->138 PF08241 * Methyltransf_11 2e-25 34.8 92/95  
:BLT:SWISS 1->251 BIOC_ECOLI 1e-95 66.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67623.1 GT:GENE bioC GT:PRODUCT biotin biosynthesis protein BioC GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 910617..911372 GB:FROM 910617 GB:TO 911372 GB:DIRECTION + GB:GENE bioC GB:PRODUCT biotin biosynthesis protein BioC GB:NOTE identified by match to protein family HMM PF01209; match to protein family HMM PF08241; match to protein family HMM PF08242; match to protein family HMM TIGR02072 GB:PROTEIN_ID ACF67623.1 GB:DB_XREF GI:194407404 GB:GENE:GENE bioC LENGTH 251 SQ:AASEQ MAQVNKQAIAAAFGRAASQYEQHASLQQHSADALLTLLTGRQFASVLDAGCGPGRMSRYWRERGSEVTALDLSLPMLQQARDRQAAHHYLLADIEAIPHDAEVFDLAWSNLAVQWCGDLRDALSELYRVVRPGGVVAFTTLCQGSLPELRQAWQAVDNRAHANSFLPEEAIDHALRGWRAFRHTQAMTLWFEDALSAMRSLKGIGATHLHEGRETDVLTRARLRQIQLAWPQRQGKYPLTYHLFMGVIERD GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 1->251|BIOC_ECOLI|1e-95|66.5|251/251| BL:PDB:NREP 1 BL:PDB:REP 46->140|3bkwB|3e-08|32.6|95/212| RP:PDB:NREP 1 RP:PDB:REP 11->176|3cggB|9e-21|15.1|166/182| RP:PFM:NREP 1 RP:PFM:REP 47->134|PF08241|3e-14|40.9|88/96|Methyltransf_11| HM:PFM:NREP 1 HM:PFM:REP 47->138|PF08241|2e-25|34.8|92/95|Methyltransf_11| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 44->213|2avnA1|9e-21|25.8|163/246|c.66.1.41| HM:SCP:REP 9->177|1wznA1|4.8e-38|31.1|167/0|c.66.1.43|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 459 OP:NHOMOORG 397 OP:PATTERN -------------------------11--1-------------12--2-------------------- 1-1-1---------1--11-1-----11111--1111----1------------------121-1--1-12---------------11-----111-----------------------------1--1----1-11--------1--1--------------1-1111----------------1------1-111111121122112-211--111--1----------22----------------------------------------------------------------------------------------------1--------------------1------1---------1---------------------11---------11111111111---------1-------------1-------11------111111111---1-1--11--1111----------------------1-1--2----122323-----2212------3112111----1--1--1---1-1-211111111111111111221---11----2----111111211----1--11--------------------1--1111111111111111111111111111111111--1222-1----11211211111111111-11111111111111111111212111111111112111111113111111111111111111111--1122222111121111111------------111111----1111311341122111111---------11111111111111111121221121111111-------------------------------------------------------- -----------------------------------------------------------1-1-------------------------------------1------------11--11----1-11-2-121-1111---1-11------1----21--------1-------1------1------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 99.6 SQ:SECSTR HHHccHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHcTTcEEEEETcTTcHHHHHHHHTTcEEEEEEccHHHHHHHHHHcTTcEEEcTTTcccccccEEEEEEcccHHHccGGGHHHHHHHHHHHEEEEEEEEEEEETTccccHHHHHHHHHHHTEEEEEEEccTTcccccTHEEEEEEEEEccEEcccGGGHHHHHHHcHHHHTTccHHHHHHHHHHHHHHHHHHHEETTEEEEccEEEEEEEEE# DISOP:02AL 1-5| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHcccccEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccEEEEEEEEEcccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccEEEEEEEEEEEEEEc //