[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : bioF
DDBJ      :bioF         8-amino-7-oxononanoate synthase
Swiss-Prot:BIOF_SALHS   RecName: Full=8-amino-7-oxononanoate synthase;         Short=AONS;         EC=2.3.1.47;AltName: Full=8-amino-7-ketopelargonate synthase;AltName: Full=7-keto-8-amino-pelargonic acid synthetase;         Short=7-KAP synthetase;AltName: Full=L-alanine--pimeloyl-CoA ligase;

Homologs  Archaea  23/68 : Bacteria  688/915 : Eukaryota  195/199 : Viruses  1/175   --->[See Alignment]
c.67.1
:385 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->384 1bs0A PDBj e-138 68.1 %
:RPS:PDB   4->385 3a2bA PDBj e-103 28.1 %
:RPS:SCOP  2->384 1bs0A  c.67.1.4 * e-142 73.6 %
:HMM:SCOP  2->384 1bs0A_ c.67.1.4 * 8.5e-108 39.4 %
:RPS:PFM   88->128 PF01053 * Cys_Met_Meta_PP 8e-05 53.7 %
:HMM:PFM   40->379 PF00155 * Aminotran_1_2 1.3e-66 27.1 332/363  
:BLT:SWISS 1->385 BIOF_SALHS 0.0 100.0 %
:PROS 233->242|PS00599|AA_TRANSFER_CLASS_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68113.1 GT:GENE bioF GT:PRODUCT 8-amino-7-oxononanoate synthase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 909476..910633 GB:FROM 909476 GB:TO 910633 GB:DIRECTION + GB:GENE bioF GB:PRODUCT 8-amino-7-oxononanoate synthase GB:NOTE identified by match to protein family HMM PF00155; match to protein family HMM PF00202; match to protein family HMM PF00266; match to protein family HMM PF01212; match to protein family HMM TIGR00858 GB:PROTEIN_ID ACF68113.1 GB:DB_XREF GI:194407894 GB:GENE:GENE bioF LENGTH 385 SQ:AASEQ MSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFGVGSGGSGHISGYSVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAANLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIGVTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMPPAQAQALSASLAVIRSDEGGERREKLAALVQRFRAGVNASRFTLLNAHSAIQPLIVGDNSRALRLAEALRQQGCWATAIRPPTVPVGTARLRLTLTQAHEACDIDRLLEVLHGAGE GT:EXON 1|1-385:0| SW:ID BIOF_SALHS SW:DE RecName: Full=8-amino-7-oxononanoate synthase; Short=AONS; EC=2.3.1.47;AltName: Full=8-amino-7-ketopelargonate synthase;AltName: Full=7-keto-8-amino-pelargonic acid synthetase; Short=7-KAP synthetase;AltName: Full=L-alanine--pimeloyl-CoA ligase; SW:GN Name=bioF; OrderedLocusNames=SeHA_C0922; SW:KW Biotin biosynthesis; Complete proteome; Pyridoxal phosphate;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->385|BIOF_SALHS|0.0|100.0|385/385| GO:SWS:NREP 2 GO:SWS GO:0009102|"GO:biotin biosynthetic process"|Biotin biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 233->242|PS00599|AA_TRANSFER_CLASS_2|PDOC00518| SEG 70->83|gvgsggsghisgys| SEG 269->281|ppaqaqalsasla| BL:PDB:NREP 1 BL:PDB:REP 2->384|1bs0A|e-138|68.1|383/383| RP:PDB:NREP 1 RP:PDB:REP 4->385|3a2bA|e-103|28.1|377/392| RP:PFM:NREP 1 RP:PFM:REP 88->128|PF01053|8e-05|53.7|41/384|Cys_Met_Meta_PP| HM:PFM:NREP 1 HM:PFM:REP 40->379|PF00155|1.3e-66|27.1|332/363|Aminotran_1_2| GO:PFM:NREP 2 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01053|IPR000277| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF01053|IPR000277| RP:SCP:NREP 1 RP:SCP:REP 2->384|1bs0A|e-142|73.6|383/383|c.67.1.4| HM:SCP:REP 2->384|1bs0A_|8.5e-108|39.4|383/0|c.67.1.4|1/1|PLP-dependent transferases| OP:NHOMO 2350 OP:NHOMOORG 907 OP:PATTERN --1---------------------1--1---1----1111111-----------1111111-111-11 112-1-1-----1-11122-211171222225111121131231-111----2111-2--3222315333-------------111114434-433---22434342326111111121222221222334223131-------1-2121112--111111112111111211111111111111111112112222222222222222-1221222211-1111------2112222223222222211111-----------------1----------------------------------------------------111----------------------1--1---1-------1--111111-2225334-----452452223343322222222222-565564542822233232532234232333223233523333333332443323222322222221111111111111111111-23333121132333324333333223333234233232112321111-124-1-1112111311111111322111--1111212221111212211112222243221--1-11111111111111111111222212112222222222222222222222221--1111-1----22222222223233333-23233333332333223322222222222222222222222224222332211222222222222--1222222333311412111-1-111111--1-111111111211111111111121111133222332312223333333332222222222221111111-111111--------1------------------1--------11111-1---132 22--334-52314445653466668674444547443444444444544545554543433343333323323332323333333344-4A5645464444447641534B9B86885235553946B2GZA178955249566856544634D366668AB57664644H56654132L3233548C56533497763 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-- STR:NPRED 385 STR:RPRED 100.0 SQ:SECSTR ccHTccHHHHHHHTTGGGccccccccccccccEEEETTEEEEEcccccTTcGGGcHHHHHHHHHHHHHHcccccccTTTTcccHHHHHHHHHHHHHHTccEEEEEccHHHHHHHHHHHcccTTcEEEEETTccHHHHHHHHHcccEEEEEcTTcHHHHHHHHHTcccccEEEEEEcccTTTcccccHHHHHHHHHHHTcEEEEEcTTTTTTccGGGccHHHHHTcGGGEEEEEcccTTccccEEEEEcHHHHHHHHHHcHHHHccccccHHHHHHHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHTTcccccccccEEEEEcccHHHHHHHHHHHHHTTEEcEEEcTTTccGGGcEEEEEccTTccHHHHHHHHHHHHHHHH DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHccccccccccccccccEEEEccEEEEEccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHcccEEEEEccccccEEccccccHHHHHccccEEEEEEccHHcccccEEEEEcHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHccEEEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHcc //