[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ccmB.1
DDBJ      :ccmB         heme exporter protein CcmB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  186/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:PSIPRED
:RPS:PFM   8->124 PF03379 * CcmB 7e-20 46.2 %
:HMM:PFM   1->215 PF03379 * CcmB 5.9e-82 58.1 215/215  
:BLT:SWISS 2->218 CCMB_SHIFL 3e-47 82.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67748.1 GT:GENE ccmB.1 GT:PRODUCT heme exporter protein CcmB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2399969..2400625) GB:FROM 2399969 GB:TO 2400625 GB:DIRECTION - GB:GENE ccmB GB:PRODUCT heme exporter protein CcmB GB:NOTE identified by match to protein family HMM PF03379; match to protein family HMM TIGR01190 GB:PROTEIN_ID ACF67748.1 GB:DB_XREF GI:194407529 GB:GENE:GENE ccmB LENGTH 218 SQ:AASEQ MWRVFCLELRVAFRHGADIAGPLWFFLMVITLFPLSVGPQPQLLARIAPGIIQVAALLASLLALERLFRDDLQDGSLEQLMLLPVPLPAVVLAKVLAHWAVTGLPLIMLSPLVALLLGMDVYGWKIMALTLLLGTPALGFLAAPGVGLTAGLRRGGVLLGILVLPLSVPVLIFAAAAMDAASMHLPADGYLAVLGALLAGSATLSPFATAAALRISVQ GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 2->218|CCMB_SHIFL|3e-47|82.0|217/220| TM:NTM 7 TM:REGION 17->39| TM:REGION 45->67| TM:REGION 75->97| TM:REGION 101->123| TM:REGION 127->149| TM:REGION 157->179| TM:REGION 191->213| SEG 55->64|aallasllal| SEG 80->97|lmllpvplpavvlakvla| SEG 128->172|altlllgtpalgflaapgvgltaglrrggvllgilvlplsvpvli| SEG 174->181|aaaamdaa| SEG 187->204|adgylavlgallagsatl| RP:PFM:NREP 1 RP:PFM:REP 8->124|PF03379|7e-20|46.2|117/214|CcmB| HM:PFM:NREP 1 HM:PFM:REP 1->215|PF03379|5.9e-82|58.1|215/215|CcmB| GO:PFM:NREP 4 GO:PFM GO:0015232|"GO:heme transporter activity"|PF03379|IPR003544| GO:PFM GO:0015886|"GO:heme transport"|PF03379|IPR003544| GO:PFM GO:0016020|"GO:membrane"|PF03379|IPR003544| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF03379|IPR003544| OP:NHOMO 201 OP:NHOMOORG 186 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------11-11-1-----1--111111111-------1----1--111111111--1-----------------------------------------1----------------------------111----1-------1----1--------------21--1-----------------------------------------------------------11-1-1111111111111-111111--111---1-1-------11--1-11111111111-111111111111111111111111---222-22222222222111111111--111111111111---1---------111--111111111111111----------111111-1111-1--1-11----------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHcccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //