[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : chbB
DDBJ      :chbB         PTS system, N,N'-diacetylchitobiose-specific IIB component
Swiss-Prot:PTQB_ECOLI   RecName: Full=N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIB component;         EC=2.7.1.69;AltName: Full=PTS system N,N'-diacetylchitobiose-specific EIIB component;

Homologs  Archaea  0/68 : Bacteria  204/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.44.2
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->93 1e2bA PDBj 7e-46 94.6 %
:RPS:PDB   1->93 1e2bA PDBj 5e-11 94.6 %
:RPS:SCOP  3->93 1iibA  c.44.2.1 * 1e-11 94.5 %
:HMM:SCOP  3->105 1iibA_ c.44.2.1 * 3.2e-29 48.5 %
:RPS:PFM   6->80 PF02302 * PTS_IIB 2e-06 45.1 %
:HMM:PFM   6->94 PF02302 * PTS_IIB 9.1e-19 43.0 86/90  
:BLT:SWISS 1->93 PTQB_ECOLI 1e-46 95.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69796.1 GT:GENE chbB GT:PRODUCT PTS system, N,N'-diacetylchitobiose-specific IIB component GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1396852..1397172 GB:FROM 1396852 GB:TO 1397172 GB:DIRECTION + GB:GENE chbB GB:PRODUCT PTS system, N,N'-diacetylchitobiose-specific IIB component GB:NOTE identified by match to protein family HMM PF02302; match to protein family HMM TIGR00853 GB:PROTEIN_ID ACF69796.1 GB:DB_XREF GI:194409577 GB:GENE:GENE chbB LENGTH 106 SQ:AASEQ MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGPAADVVLLGPQIAYMLPEIQRLLPGKPVEVIDSMLYGKVDGLGVLKAAVAAIKKAAAN GT:EXON 1|1-106:0| SW:ID PTQB_ECOLI SW:DE RecName: Full=N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIB component; EC=2.7.1.69;AltName: Full=PTS system N,N'-diacetylchitobiose-specific EIIB component; SW:GN Name=chbB; Synonyms=celA; OrderedLocusNames=b1738, JW1727; SW:KW 3D-structure; Complete proteome; Cytoplasm; Kinase;Phosphotransferase system; Sugar transport; Transferase; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->93|PTQB_ECOLI|1e-46|95.7|93/106| GO:SWS:NREP 6 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|Phosphotransferase system| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 94->105|kaavaaikkaaa| BL:PDB:NREP 1 BL:PDB:REP 1->93|1e2bA|7e-46|94.6|93/106| RP:PDB:NREP 1 RP:PDB:REP 1->93|1e2bA|5e-11|94.6|93/106| RP:PFM:NREP 1 RP:PFM:REP 6->80|PF02302|2e-06|45.1|71/86|PTS_IIB| HM:PFM:NREP 1 HM:PFM:REP 6->94|PF02302|9.1e-19|43.0|86/90|PTS_IIB| GO:PFM:NREP 2 GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF02302|IPR003501| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02302|IPR003501| RP:SCP:NREP 1 RP:SCP:REP 3->93|1iibA|1e-11|94.5|91/103|c.44.2.1| HM:SCP:REP 3->105|1iibA_|3.2e-29|48.5|103/103|c.44.2.1|1/1|PTS system, Lactose/Cellobiose specific IIB subunit| OP:NHOMO 362 OP:NHOMOORG 205 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------2333322331322323224432333-1211-3677776---------------------121--22-----22--221-12-211111113331--222222222221111111111111122---222--1-181111111111-4---112-------1------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12----------------------------------------2211-311112121222-1112211222121111112365331111111111111111111311-1111--311111111111-------------------------------1-----------------------------------------1121111111--------------------1-------11---------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 87.7 SQ:SECSTR cccEEEEEEccccTTTHHHHHHHHHHHHHccccEEEEEEccccTTHHHHHccEEEEcTTcGGGHHHHHHHccccccccccHHHHTTTcTTHHH############# DISOP:02AL 1-1,103-107| PSIPRED ccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHccccEEEEcHHHHHHHHHHHHHHccccEEEEcHHHHccccHHHHHHHHHHHHHHHccc //