[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cheY
DDBJ      :cheY         chemotaxis response regulator CheY
Swiss-Prot:CHEY_SALTY   RecName: Full=Chemotaxis protein cheY;

Homologs  Archaea  15/68 : Bacteria  640/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->129 2cheA PDBj 5e-60 100.0 %
:RPS:PDB   2->129 1c4wA PDBj 2e-20 71.7 %
:RPS:SCOP  2->129 1a0oA  c.23.1.1 * 2e-36 86.7 %
:HMM:SCOP  3->125 1s8nA_ c.23.1.1 * 1.1e-33 39.2 %
:RPS:PFM   9->111 PF00072 * Response_reg 1e-12 38.0 %
:HMM:PFM   9->120 PF00072 * Response_reg 4.9e-34 40.0 110/112  
:BLT:SWISS 1->129 CHEY_SALTY 4e-60 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68729.1 GT:GENE cheY GT:PRODUCT chemotaxis response regulator CheY GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2060623..2061012) GB:FROM 2060623 GB:TO 2061012 GB:DIRECTION - GB:GENE cheY GB:PRODUCT chemotaxis response regulator CheY GB:NOTE identified by match to protein family HMM PF00072 GB:PROTEIN_ID ACF68729.1 GB:DB_XREF GI:194408510 GB:GENE:GENE cheY LENGTH 129 SQ:AASEQ MADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM GT:EXON 1|1-129:0| SW:ID CHEY_SALTY SW:DE RecName: Full=Chemotaxis protein cheY; SW:GN Name=cheY; OrderedLocusNames=STM1916; SW:KW 3D-structure; Acetylation; Chemotaxis; Complete proteome; Cytoplasm;Flagellar rotation; Magnesium; Metal-binding; Phosphoprotein;Two-component regulatory system. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->129|CHEY_SALTY|4e-60|100.0|129/129| GO:SWS:NREP 5 GO:SWS GO:0006935|"GO:chemotaxis"|Chemotaxis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0001539|"GO:ciliary or flagellar motility"|Flagellar rotation| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|Two-component regulatory system| SEG 88->101|aeakkeniiaaaqa| BL:PDB:NREP 1 BL:PDB:REP 2->129|2cheA|5e-60|100.0|128/128| RP:PDB:NREP 1 RP:PDB:REP 2->129|1c4wA|2e-20|71.7|127/127| RP:PFM:NREP 1 RP:PFM:REP 9->111|PF00072|1e-12|38.0|100/111|Response_reg| HM:PFM:NREP 1 HM:PFM:REP 9->120|PF00072|4.9e-34|40.0|110/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 2->129|1a0oA|2e-36|86.7|128/128|c.23.1.1| HM:SCP:REP 3->125|1s8nA_|1.1e-33|39.2|120/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 2577 OP:NHOMOORG 679 OP:PATTERN -----------------------1-----------2---1--1-2-18-2314-1-1-11-------- 3341--1-111---1------1----------1222-11121--3---21-----1------4-3--1-2-----------1--111232E9-1------25-412-424----------------1-11---1215444433251H7C99937634111331366277953211233231221-1---112226666657666677572422327674447331232223872--------------211112--1--11--12222-----12-11-1111---2112222222222211111111-1111211---111-356265554343-4136662222124115564297343132423244-1-551BCC8-----2358934356657----------1-44547645226-3334564444432-437221666434---------34421D56------------------------------2121112212A786997444444784445356767968--976C3645825554586668674-------2322AD4CA623952GC6692JAHABAF547567FAB33321-22222321222222233421--751877223528435564235534644367--13654------34332324444444444-4434444444444444443334233333332333333333323344344441-423333223332---3---------33A19-------1111----12222-222139988865A97556845571--------42326566663246677767655662212--9222112211121222----------------------------23-12-2----5- ----11--------2---1-------------------------11-----------------------------------------1--------1---111-21---1------------------------------------------------2----1---------1--1---222--4--11--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 100.0 SQ:SECSTR cccTTccEEEEcccHHHHHHHHHHHHHTTcccEEEEEccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHTcTTTTTccEEEEEccccHHHHHHHHHTTccEEEEccccHHHHHHHHHHHHHHTTc DISOP:02AL 1-4| PSIPRED ccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHcc //