[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : citG.2
DDBJ      :citG         triphosphoribosyl-dephospho-CoA synthase CitG
Swiss-Prot:CITG2_SALTY  RecName: Full=Probable 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase 2;         Short=2-(5''-triphosphoribosyl)-3'-dephospho-CoA synthase 2;         EC=2.7.8.25;

Homologs  Archaea  0/68 : Bacteria  178/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->290 PF01874 * CitG 2e-50 51.0 %
:HMM:PFM   21->290 PF01874 * CitG 1.1e-90 46.8 263/277  
:BLT:SWISS 1->297 CITG2_SALTY e-159 99.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67675.1 GT:GENE citG.2 GT:PRODUCT triphosphoribosyl-dephospho-CoA synthase CitG GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(730835..731728) GB:FROM 730835 GB:TO 731728 GB:DIRECTION - GB:GENE citG GB:PRODUCT triphosphoribosyl-dephospho-CoA synthase CitG GB:NOTE identified by match to protein family HMM PF01874; match to protein family HMM TIGR03125 GB:PROTEIN_ID ACF67675.1 GB:DB_XREF GI:194407456 GB:GENE:GENE citG LENGTH 297 SQ:AASEQ MPIPANPTNASIQPQSLYDAWADLAWRAMLTEVNLSPKPGLVDRLNCGAHKDMALADFHRSAEAIRHWLPRFMEYGASCTRLPPESVLAGLRPLGMACEAAMFRATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPIAAETLCATAADFCRGLTTRELRQNNLQLTAGQRLYQQLGLTGARGEAEAGYPLVIRHALPHYRALLAQGRDPELALLDTLLLLMSLNGDTNVASRGGADGLRWLQQQAAVLLQQGGIRTPDDLVYLHRFDQQCIERNLSPGGSADLLIVTWFLAQISQVNH GT:EXON 1|1-297:0| SW:ID CITG2_SALTY SW:DE RecName: Full=Probable 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase 2; Short=2-(5''-triphosphoribosyl)-3'-dephospho-CoA synthase 2; EC=2.7.8.25; SW:GN Name=citG2; OrderedLocusNames=STM0619; SW:KW ATP-binding; Complete proteome; Nucleotide-binding; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->297|CITG2_SALTY|e-159|99.7|297/298| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 210->222|lalldtllllmsl| SEG 240->250|lqqqaavllqq| RP:PFM:NREP 1 RP:PFM:REP 20->290|PF01874|2e-50|51.0|263/268|CitG| HM:PFM:NREP 1 HM:PFM:REP 21->290|PF01874|1.1e-90|46.8|263/277|CitG| OP:NHOMO 206 OP:NHOMOORG 178 OP:PATTERN -------------------------------------------------------------------- ----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--11---1-11--111--1-1------1111-11-----------111111111--11-----------1------------------1-1-1--------------1--------1--------------12----1-2-11-----------------1-1----------------------------------------------1--------------------------------1-------1111111------11-----1111-1-------12---1--21-12-------------------1---------------1-1-----1---------------------------------------------1--------------------------------212212-1111111111-112111111111111111222111---2212222222222222111--111--1---------------------111--------11-11111----11111-11--1-1111-11---1-11111-------------111111-----1111111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-10,296-298| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHEEcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccc //