[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cpsB
DDBJ      :cpsB         mannose-1-phosphate guanylyltransferase
Swiss-Prot:MANC_SALTY   RecName: Full=Mannose-1-phosphate guanylyltransferase manC;         EC=2.7.7.13;AltName: Full=GDP-mannose pyrophosphorylase;         Short=GMPP;         Short=GMP;

Homologs  Archaea  26/68 : Bacteria  526/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
b.81.4b.82.1c.68.1
:478 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->357 2cu2A PDBj 4e-37 35.5 %
:BLT:PDB   401->445 1j58A PDBj 8e-04 35.6 %
:RPS:PDB   9->67 2e3dC PDBj 3e-06 22.8 %
:RPS:PDB   106->476 2bq1E PDBj 6e-61 11.0 %
:RPS:SCOP  5->292 2cu2A2  c.68.1.20 * 1e-51 34.5 %
:RPS:SCOP  295->357 2cu2A1  b.81.4.1 * 2e-11 19.0 %
:RPS:SCOP  332->477 1fi2A  b.82.1.2 * 7e-29 15.8 %
:HMM:SCOP  1->304 1yp2A2 c.68.1.6 * 9e-56 32.3 %
:HMM:SCOP  193->477 1j58A_ b.82.1.2 * 9.6e-91 44.1 %
:RPS:PFM   9->287 PF00483 * NTP_transferase 6e-16 37.3 %
:RPS:PFM   332->473 PF01050 * MannoseP_isomer 3e-61 74.6 %
:HMM:PFM   8->294 PF00483 * NTP_transferase 1.3e-83 44.6 242/248  
:HMM:PFM   323->473 PF01050 * MannoseP_isomer 5e-79 76.8 151/151  
:BLT:SWISS 1->478 MANC_SALTY 0.0 99.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70405.1 GT:GENE cpsB GT:PRODUCT mannose-1-phosphate guanylyltransferase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2236089..2237525) GB:FROM 2236089 GB:TO 2237525 GB:DIRECTION - GB:GENE cpsB GB:PRODUCT mannose-1-phosphate guanylyltransferase GB:NOTE identified by match to protein family HMM PF00483; match to protein family HMM PF01050; match to protein family HMM PF07883; match to protein family HMM TIGR01479 GB:PROTEIN_ID ACF70405.1 GB:DB_XREF GI:194410186 GB:GENE:GENE cpsB LENGTH 478 SQ:AASEQ MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAATRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYADAGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRAGRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDVGSWSSLWEISAHTPEGNVHHGDVISHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRHAVQDVKKVVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVTINGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRI GT:EXON 1|1-478:0| SW:ID MANC_SALTY SW:DE RecName: Full=Mannose-1-phosphate guanylyltransferase manC; EC=2.7.7.13;AltName: Full=GDP-mannose pyrophosphorylase; Short=GMPP; Short=GMP; SW:GN Name=manC; Synonyms=cpsB; OrderedLocusNames=STM2105; SW:KW Capsule biogenesis/degradation; Complete proteome; GTP-binding;Lipopolysaccharide biosynthesis; Nucleotide-binding;Nucleotidyltransferase; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->478|MANC_SALTY|0.0|99.6|478/480| GO:SWS:NREP 5 GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0009103|"GO:lipopolysaccharide biosynthetic process"|Lipopolysaccharide biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 92->102|apaialaalaa| SEG 318->331|glvttvgvkdlvvv| BL:PDB:NREP 2 BL:PDB:REP 5->357|2cu2A|4e-37|35.5|332/335| BL:PDB:REP 401->445|1j58A|8e-04|35.6|45/364| RP:PDB:NREP 2 RP:PDB:REP 9->67|2e3dC|3e-06|22.8|57/288| RP:PDB:REP 106->476|2bq1E|6e-61|11.0|363/675| RP:PFM:NREP 2 RP:PFM:REP 9->287|PF00483|6e-16|37.3|228/238|NTP_transferase| RP:PFM:REP 332->473|PF01050|3e-61|74.6|142/151|MannoseP_isomer| HM:PFM:NREP 2 HM:PFM:REP 8->294|PF00483|1.3e-83|44.6|242/248|NTP_transferase| HM:PFM:REP 323->473|PF01050|5e-79|76.8|151/151|MannoseP_isomer| GO:PFM:NREP 4 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00483|IPR005835| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF00483|IPR005835| GO:PFM GO:0005976|"GO:polysaccharide metabolic process"|PF01050|IPR001538| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01050|IPR001538| RP:SCP:NREP 3 RP:SCP:REP 5->292|2cu2A2|1e-51|34.5|267/268|c.68.1.20| RP:SCP:REP 295->357|2cu2A1|2e-11|19.0|63/67|b.81.4.1| RP:SCP:REP 332->477|1fi2A|7e-29|15.8|146/201|b.82.1.2| HM:SCP:REP 1->304|1yp2A2|9e-56|32.3|260/0|c.68.1.6|1/1|Nucleotide-diphospho-sugar transferases| HM:SCP:REP 193->477|1j58A_|9.6e-91|44.1|281/0|b.82.1.2|1/1|RmlC-like cupins| OP:NHOMO 823 OP:NHOMOORG 564 OP:PATTERN -----------------------111111--------1-111-11-11-1222-1111111---1--- 111-1---------------------------------------11121111111111111131--------111-------11111-222313111--21111121121---------------22222222212--------112332333222222222233113333121121121111-111111-1-----------1----1-------1-11----1------13------------------------------------------------------------------------------------------2--31111111111211111211-1----2-11--12-21---11-2--12111111-----211112121111222222222221-22122431121-11111121111111111211211112-1111111111111111--------------11-21---11-2-111111111----4433442244422463333234552-2111-1-221-1-1222-111122111-------11121111111221111111122322222211111132--11-------1111111111-121321-22111-111--1------1------------1111------1111-2-1222112111-2112121221212221222-2111---2122222222222222111-11111-111-111111-1----11111111111121---------------------1---11323323233211212332121222211----111111-1-1111111111111111-11111111------------------------------------111111-111121 ------------------------------------------------11---------------------------------------121-111------1------------------------------------------------------------1---------1--------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 478 STR:RPRED 100.0 SQ:SECSTR TccccEEEEEEcccccGGGTTTccTTccGGGcccGGGccHHHHHHHHHTTTccGGGEEEEEEGGGHHHHGGGccccccGGEEEEEccccHHHHHHHHHHHHHHHHHHHHHGGGGcccTTTcccTHHHHHHHHHHHHHHTTTTTccccccHHHHHHHHHHTTcccHHHHTTccHHHHTTcccccccHHHHHHHHccccccccccHHHHHHHHHHTTTcHHHHHHHHHHHTTcEEEcHHHHHHTTcccccEEEEccccHHEHHHHHHHHHHHHHHTTcEEEEEcGGGcccTTcccTTcccccccHHHHHHHHHHHHHcTccEEEEEEETTcTTHHHGGGccccEEEEEEccHHHHHcHHHHHHHHcccGGGccHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHcccEEEcHHHHHHTccccccEEEEccEEEETTcccEEEccccEEcTTccEEEccccEEEEEHHHHHHccccE DISOP:02AL 1-4| PSIPRED cccccEEEEEEcccccccccccccccccccEEEccccccHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHHHHHcccEEEEEEEEcccccccEEEEEcccccccccccEEEEEEEEEcccHHHHHHHHHcccEEEEccEEEEEHHHHHHHHHHHcHHHHHHHHHHHHccccccccEEEcHHHHHHcccccccHHHHcccccEEEEEccccccccccHHHHHHHHcccccccEEEccEEEEccccEEEEEcccEEEEEEcccEEEEEcccEEEEEEHHHHHHHHHHHHHHHHccccccccccEEEccccEEEEEEEcccEEEEEEEEcccccccccccccccEEEEEEEEEEEEEEccEEEEEccccEEEEccccEEEEEEcccccEEEEEEEcccccccccEEEEcHHcccc //