[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : crcB
DDBJ      :crcB         CrcB protein
Swiss-Prot:CRCB_SALTY   RecName: Full=Protein crcB homolog;

Homologs  Archaea  6/68 : Bacteria  297/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:RPS:PFM   5->107 PF02537 * CRCB 8e-16 48.5 %
:HMM:PFM   6->118 PF02537 * CRCB 2.5e-32 38.1 113/117  
:BLT:SWISS 1->114 CRCB_SALTY 5e-64 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66217.1 GT:GENE crcB GT:PRODUCT CrcB protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(741611..741994) GB:FROM 741611 GB:TO 741994 GB:DIRECTION - GB:GENE crcB GB:PRODUCT CrcB protein GB:NOTE identified by match to protein family HMM PF02537; match to protein family HMM TIGR00494 GB:PROTEIN_ID ACF66217.1 GB:DB_XREF GI:194405998 GB:GENE:GENE crcB LENGTH 127 SQ:AASEQ MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTHIDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWLFSAAAAR GT:EXON 1|1-127:0| SW:ID CRCB_SALTY SW:DE RecName: Full=Protein crcB homolog; SW:GN Name=crcB; OrderedLocusNames=STM0630; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->114|CRCB_SALTY|5e-64|100.0|114/127| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 1->23| TM:REGION 28->50| TM:REGION 66->88| TM:REGION 100->122| SEG 115->126|alafwlfsaaaa| RP:PFM:NREP 1 RP:PFM:REP 5->107|PF02537|8e-16|48.5|103/115|CRCB| HM:PFM:NREP 1 HM:PFM:REP 6->118|PF02537|2.5e-32|38.1|113/117|CRCB| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02537|IPR003691| OP:NHOMO 318 OP:NHOMOORG 304 OP:PATTERN -----------------------------------11--111-------------1------------ 111-----------1---------------------1----------------------------------1111---1-1----11111-1-------11-1------------------------111-1111-------------------1-----------------------------------1-1--------------------1-----21-------------11111111-111111--12---------------------------------1--11111111111---------------------------1-------------------------------------1------1-----------------1-------11--1-----1--------1-----11-----------1----------1-222222221--1--------------------------------------------1111111111111111-11111111--1-1----1111-1111111111--1111-----111--1-1-1----1-1-------1----1-------------1111-----------11111--111-11-11111111111111111111111-------------11111111111111211-112111111112111111121111111111111111111111111111111--111111111111-----1--1------11----11---------11111111----111111111----1--------------1---1111111111-------11-------------11------------------------------------11----------1 ------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //