[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : crr
DDBJ      :crr          PTS system, glucose-specific IIA component
Swiss-Prot:PTGA_SALTY   RecName: Full=Glucose-specific phosphotransferase enzyme IIA component;         EC=2.7.1.-;AltName: Full=PTS system glucose-specific EIIA component;AltName: Full=EIIA-Glc;AltName: Full=EIII-Glc;

Homologs  Archaea  0/68 : Bacteria  402/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.84.3
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->169 1glaF PDBj 1e-80 98.0 %
:RPS:PDB   22->124 3bg5A PDBj 2e-18 11.7 %
:RPS:SCOP  20->169 1f3gA  b.84.3.1 * 2e-35 98.0 %
:HMM:SCOP  14->167 2gprA_ b.84.3.1 * 1.4e-54 46.8 %
:RPS:PFM   22->147 PF00358 * PTS_EIIA_1 5e-33 57.1 %
:HMM:PFM   20->149 PF00358 * PTS_EIIA_1 8.3e-57 55.4 130/133  
:BLT:SWISS 1->169 PTGA_SALTY 2e-83 100.0 %
:PROS 85->97|PS00371|PTS_EIIA_TYPE_1_HIS
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68774.1 GT:GENE crr GT:PRODUCT PTS system, glucose-specific IIA component GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2604611..2605120 GB:FROM 2604611 GB:TO 2605120 GB:DIRECTION + GB:GENE crr GB:PRODUCT PTS system, glucose-specific IIA component GB:NOTE identified by match to protein family HMM PF00358; match to protein family HMM TIGR00830 GB:PROTEIN_ID ACF68774.1 GB:DB_XREF GI:194408555 GB:GENE:GENE crr LENGTH 169 SQ:AASEQ MGLFDKLKSLVSDDKKDTGTIEIVAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMVAPVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDPVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETPVIRIKK GT:EXON 1|1-169:0| SW:ID PTGA_SALTY SW:DE RecName: Full=Glucose-specific phosphotransferase enzyme IIA component; EC=2.7.1.-;AltName: Full=PTS system glucose-specific EIIA component;AltName: Full=EIIA-Glc;AltName: Full=EIII-Glc; SW:GN Name=crr; OrderedLocusNames=STM2433; SW:KW Complete proteome; Cytoplasm; Kinase; Phosphotransferase system;Sugar transport; Transferase; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->169|PTGA_SALTY|2e-83|100.0|169/169| GO:SWS:NREP 6 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|Phosphotransferase system| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 85->97|PS00371|PTS_EIIA_TYPE_1_HIS|PDOC00528| SEG 5->17|dklkslvsddkkd| BL:PDB:NREP 1 BL:PDB:REP 20->169|1glaF|1e-80|98.0|150/161| RP:PDB:NREP 1 RP:PDB:REP 22->124|3bg5A|2e-18|11.7|103/1137| RP:PFM:NREP 1 RP:PFM:REP 22->147|PF00358|5e-33|57.1|126/132|PTS_EIIA_1| HM:PFM:NREP 1 HM:PFM:REP 20->149|PF00358|8.3e-57|55.4|130/133|PTS_EIIA_1| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00358|IPR001127| GO:PFM GO:0006810|"GO:transport"|PF00358|IPR001127| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00358|IPR001127| GO:PFM GO:0016020|"GO:membrane"|PF00358|IPR001127| RP:SCP:NREP 1 RP:SCP:REP 20->169|1f3gA|2e-35|98.0|150/150|b.84.3.1| HM:SCP:REP 14->167|2gprA_|1.4e-54|46.8|154/0|b.84.3.1|1/1|Duplicated hybrid motif| OP:NHOMO 1024 OP:NHOMOORG 404 OP:PATTERN -------------------------------------------------------------------- ----131122415------------1-----------111-----1-11-1--12--------311111111---2112---1-----------------------------------------------------------------------------------------------------1-----1-232222222332222223455643222221235244625123444444444444443222479-47512659GG226832745232344454444444444444443444444444444444444434444---6B8889879272-C11211111-1-212-----1---1--211--13---122---------------------------------1-----------------------------------------------------------------------------------1--------111111111111111111111111--1-----1------------------2----------------------------------------------------------------------1--111-----1-11111111111111111111-------11-11123432423223333333-2333233323232333333343553232222222222222222322233332-322222222222--1---------------111312111111111------------11111212-------------------11111111111111-----------------3------11111111-------6---11211111115111---------------- -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 89.9 SQ:SECSTR #################TcccEEEEEEETTEEEEEEEEcccccccccccccccTTcTTEEEccccEEEEEEcTTcEEcTTcEEEEEEccccEEEEEccccEEccEEcccTTcEEcTTcEEEEccEEEccccccEEEcccEEcccccHHHHcccTcEEcTTccccEEEEc DISOP:02AL 1-2,11-14| PSIPRED cccHHHHHHHHcccccccccEEEEcccccEEEEHHHcccHHHcccccccEEEEEEcccEEEEEEEEEEEEEEccccEEEEEEccccEEEEEEccccEEccccccEEEEEcccEEEcccEEEEEcHHHHHHcccccEEEEEEccHHHEEEEEEccccEEEcccEEEEEEc //