[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cueR.2
DDBJ      :cueR         Cu(I)-responsive transcriptional regulator
Swiss-Prot:CUER_SALTY   RecName: Full=HTH-type transcriptional regulator cueR;AltName: Full=Copper efflux regulator;AltName: Full=Copper export regulator;

Homologs  Archaea  0/68 : Bacteria  440/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->128 1q05B PDBj 3e-64 92.1 %
:RPS:PDB   1->138 3d70A PDBj 3e-22 18.2 %
:RPS:SCOP  3->103 1jbgA  a.6.1.3 * 9e-21 21.8 %
:HMM:SCOP  1->127 1q06A_ a.6.1.3 * 7.4e-34 37.8 %
:RPS:PFM   3->39 PF00376 * MerR 4e-07 52.8 %
:RPS:PFM   44->108 PF09278 * MerR-DNA-bind 1e-05 40.0 %
:HMM:PFM   45->108 PF09278 * MerR-DNA-bind 2.2e-19 46.9 64/65  
:HMM:PFM   2->39 PF00376 * MerR 1.2e-18 47.4 38/38  
:BLT:SWISS 1->138 CUER_SALTY 1e-78 100.0 %
:PROS 4->26|PS00552|HTH_MERR_1
:COIL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66156.1 GT:GENE cueR.2 GT:PRODUCT Cu(I)-responsive transcriptional regulator GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 607804..608220 GB:FROM 607804 GB:TO 608220 GB:DIRECTION + GB:GENE cueR GB:PRODUCT Cu(I)-responsive transcriptional regulator GB:NOTE identified by match to protein family HMM PF00376; match to protein family HMM PF09278; match to protein family HMM TIGR02044 GB:PROTEIN_ID ACF66156.1 GB:DB_XREF GI:194405937 GB:GENE:GENE cueR LENGTH 138 SQ:AASEQ MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHLNELTLLRQARQVGFNLEECGELVNLFNDPRRHSADVKKRTLEKVAEIERHISELQSMRDQLLALAESCPGDDSADCPIIDNLSGCCHHKAQKPR GT:EXON 1|1-138:0| SW:ID CUER_SALTY SW:DE RecName: Full=HTH-type transcriptional regulator cueR;AltName: Full=Copper efflux regulator;AltName: Full=Copper export regulator; SW:GN Name=cueR; Synonyms=scr; OrderedLocusNames=STM0499; SW:KW Activator; Complete proteome; Copper; Cytoplasm; DNA-binding;Metal-binding; Transcription; Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->138|CUER_SALTY|1e-78|100.0|138/138| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 4->26|PS00552|HTH_MERR_1|PDOC00477| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 82->111| BL:PDB:NREP 1 BL:PDB:REP 1->128|1q05B|3e-64|92.1|127/127| RP:PDB:NREP 1 RP:PDB:REP 1->138|3d70A|3e-22|18.2|132/276| RP:PFM:NREP 2 RP:PFM:REP 3->39|PF00376|4e-07|52.8|36/37|MerR| RP:PFM:REP 44->108|PF09278|1e-05|40.0|65/65|MerR-DNA-bind| HM:PFM:NREP 2 HM:PFM:REP 45->108|PF09278|2.2e-19|46.9|64/65|MerR-DNA-bind| HM:PFM:REP 2->39|PF00376|1.2e-18|47.4|38/38|MerR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 3->103|1jbgA|9e-21|21.8|101/106|a.6.1.3| HM:SCP:REP 1->127|1q06A_|7.4e-34|37.8|127/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 1114 OP:NHOMOORG 441 OP:PATTERN -------------------------------------------------------------------- 1--1------11-1---11-1----111111-211112-2--1111-111--124-----123--21-221---------1-------------------------------------------------------1-1--1----3-1222-11-1-------11-111----------------------2222222222-224222-11133222-221--122222225----------------1-1--1-------11-------1-------3-1------------------------------------------111-----------1-11----1-----------1--------------1--4115----------2141-2--33423344437-23215352534-2333325322242523651442432211111111151-11122------------------------------333912233457886541111882122221288B3439-1783-4197524441534112-31-------13--121--------1-----------1211111-1---------------------------134325A3253134222245274492122723---2--3------32222322222222222-222222222222222222222322224333234333333322322221112--222222222222---4--------1-3522111313-32232-212333512-1-2445774445464666533----------222222222242225411211-----------22--------------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 100.0 SQ:SECSTR EEHHHHHHHHTccHHHHHHHHHTTcccccEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccEEEEEEccEEEEEEE DISOP:02AL 129-139| PSIPRED ccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccc //