[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cydB.1
DDBJ      :cydB         cytochrome D ubiquinol oxidase, subunit II
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  513/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:336 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->326 PF02322 * Cyto_ox_2 4e-37 33.6 %
:HMM:PFM   4->326 PF02322 * Cyto_ox_2 1.8e-111 42.3 319/328  
:BLT:SWISS 5->188 CYDB_ECOLI 3e-19 29.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66577.1 GT:GENE cydB.1 GT:PRODUCT cytochrome D ubiquinol oxidase, subunit II GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 457292..458302 GB:FROM 457292 GB:TO 458302 GB:DIRECTION + GB:GENE cydB GB:PRODUCT cytochrome D ubiquinol oxidase, subunit II GB:NOTE identified by match to protein family HMM PF02322; match to protein family HMM TIGR00203 GB:PROTEIN_ID ACF66577.1 GB:DB_XREF GI:194406358 GB:GENE:GENE cydB LENGTH 336 SQ:AASEQ MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRDVMVNSVAPVWDGNETWLVLGGAGLFGAFPLAYAVITDALTIPLVVMLLGLIFRGVAFEFRFKATESHRAFWDKSFIVGSILATFAQGVVVGAVVSGFQVEGRTFSGSQLDWLTPFNLFCGVGLVVTYALLGATWLIMKSEDPLHSRMCALSRPLLIVLLLVMGGVSVWTPLTHDDIAGRWFTLPNLYYFLPVPVLVLAFSVWLWRSVKKPESHARPFILTLGLIFLGFSGLGISIWPNIIPPDISLYAAAAPPQSQSFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEGYH GT:EXON 1|1-336:0| BL:SWS:NREP 1 BL:SWS:REP 5->188|CYDB_ECOLI|3e-19|29.3|184/379| TM:NTM 9 TM:REGION 10->32| TM:REGION 59->81| TM:REGION 84->104| TM:REGION 118->140| TM:REGION 160->182| TM:REGION 192->214| TM:REGION 230->251| TM:REGION 260->282| TM:REGION 301->323| SEG 61->77|lvlggaglfgafplaya| SEG 128->143|faqgvvvgavvsgfqv| SEG 194->211|lsrpllivlllvmggvsv| SEG 227->241|lpnlyyflpvpvlvl| SEG 261->279|filtlgliflgfsglgisi| RP:PFM:NREP 1 RP:PFM:REP 5->326|PF02322|4e-37|33.6|318/328|Cyto_ox_2| HM:PFM:NREP 1 HM:PFM:REP 4->326|PF02322|1.8e-111|42.3|319/328|Cyto_ox_2| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF02322|IPR003317| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02322|IPR003317| OP:NHOMO 750 OP:NHOMOORG 518 OP:PATTERN -------------------------421-1---------------------------1---------- 1111--11111------11-1---1-111111-----1111---11-11111111-11--1111-111111--------111-11-11------------11--------11111111111111111-11-11-11--------1-1111---1111-------11141---------------1------11-11111111-111111--111-111-------111111------------------------1-11---------11---11----1111--------------------------------------------------------------------1--1-11-1----11--------111111-----122111-12112111111111111-22223123211-3111-11--11131-1-11111111--1111111121111-31------------11111111111111-1---12-1222132221223111144532222-13442222-1112-2---11111-11--2-211----------12--121-11112111-11-11111111111--13-------------------------1121131121--21222211121221111211----11-------23122322222222122-2222222222222222222332223233333333333333332222222221-211111111111---112112222211113111111111111111222221211-2111212222112112111222122122-111122222122112234344221-------------------------------------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,330-337| PSIPRED ccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccEEEcccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccccc //