[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cydB.2
DDBJ      :cydB         cytochrome D ubiquinol oxidase, subunit II
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  560/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:378 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->358 PF02322 * Cyto_ox_2 3e-47 38.7 %
:HMM:PFM   6->361 PF02322 * Cyto_ox_2 9.1e-114 44.3 327/328  
:BLT:SWISS 1->378 APPB_ECOLI e-146 74.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66968.1 GT:GENE cydB.2 GT:PRODUCT cytochrome D ubiquinol oxidase, subunit II GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1939757..1940893 GB:FROM 1939757 GB:TO 1940893 GB:DIRECTION + GB:GENE cydB GB:PRODUCT cytochrome D ubiquinol oxidase, subunit II GB:NOTE identified by match to protein family HMM PF02322; match to protein family HMM TIGR00203 GB:PROTEIN_ID ACF66968.1 GB:DB_XREF GI:194406749 GB:GENE:GENE cydB LENGTH 378 SQ:AASEQ MLDYETLRFIWWLLIGVILVAFMVTDGFDMGVGCLLPLIARNDDERRVLINSVGAHWEGNQVWLILAGGALFAAWPRVYAAAFSSFYVAMILVLCALFFRPLAFDYRGKIANARWRALWDTGLVIGSLVPPVVFGIAFGNLFLGVPFAFTPQLHVDYFGTFWQLLSPFALLCGLLSLSLVIMQGGVWLQLKTEGVIRQRALSATRYSALLIVICFLLAGYWLWAGVDGFVLLTQDANGPSNPLLKGVAILPGAWMNHFIRSPLLLIIPLLGMILPILAFYACLRGQTIRGFLFASLTQACVIFTAGITLFPFVMPSSVSPLSSLTVWDSTSSQMTLEIMLVIVLIFLPIVLLYTLWSYYKMLGRINLGTLRRNDHELY GT:EXON 1|1-378:0| BL:SWS:NREP 1 BL:SWS:REP 1->378|APPB_ECOLI|e-146|74.1|378/378| TM:NTM 9 TM:REGION 14->36| TM:REGION 50->72| TM:REGION 81->103| TM:REGION 122->144| TM:REGION 165->187| TM:REGION 205->227| TM:REGION 260->282| TM:REGION 297->319| TM:REGION 335->357| SEG 164->179|llspfallcgllslsl| SEG 262->277|pllliipllgmilpil| SEG 309->324|lfpfvmpssvsplssl| SEG 340->352|lvivliflpivll| RP:PFM:NREP 1 RP:PFM:REP 7->358|PF02322|3e-47|38.7|323/328|Cyto_ox_2| HM:PFM:NREP 1 HM:PFM:REP 6->361|PF02322|9.1e-114|44.3|327/328|Cyto_ox_2| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF02322|IPR003317| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02322|IPR003317| OP:NHOMO 855 OP:NHOMOORG 568 OP:PATTERN -------------------------421-1--------------------11-----1---------- 1111--11111--111111-11--11111111111111111---11111111111-11--11111111112--------111-11-111111-111----11--------11111111111111111-11-11-11--------1-1111---1111-------11141---------------1------111222222221222222--1111222-------1111111---------------------1-1-22-11-1111122-1-1111111111---------------------------------------1----------------------------1--1-11-1----11--------11111-------221-1-12113-11111111111-22223123211-3111-111111131-1-11111111--2222222221111-31------------11--1111111111-1---12-1222133332333222255533333124542221-1112-2---11111-11--2-211----------12--111111112111111-11111111111--13-11-1-------1--------11--11221311211121222211121221111211--1-11-------22122322222222122-2222222222222222222332223233333333333333332222222221-211111111111---11211222221111311111111111111122222121112111212222112112111222122122-111133333122112234344322-------------------------------------------------------------11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 372-379| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccccHHHHcccHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEccHHHHHccccccc //