[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cyoC
DDBJ      :cyoC         cytochrome o ubiquinol oxidase, subunit III
Swiss-Prot:CYOC_SHIFL   RecName: Full=Cytochrome o ubiquinol oxidase subunit 3;         EC=1.10.3.-;AltName: Full=Cytochrome o ubiquinol oxidase subunit III;AltName: Full=Ubiquinol oxidase chain C;

Homologs  Archaea  21/68 : Bacteria  566/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
f.25.1
:204 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->203 1fftC PDBj e-102 96.6 %
:RPS:SCOP  24->203 1fftC  f.25.1.1 * 7e-40 96.1 %
:HMM:SCOP  19->203 1fftC_ f.25.1.1 * 1.9e-59 39.5 %
:RPS:PFM   27->199 PF00510 * COX3 1e-15 32.4 %
:HMM:PFM   16->202 PF00510 * COX3 4e-21 29.3 184/258  
:BLT:SWISS 25->204 CYOC_SHIFL e-102 96.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69208.1 GT:GENE cyoC GT:PRODUCT cytochrome o ubiquinol oxidase, subunit III GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(541708..542322) GB:FROM 541708 GB:TO 542322 GB:DIRECTION - GB:GENE cyoC GB:PRODUCT cytochrome o ubiquinol oxidase, subunit III GB:NOTE identified by match to protein family HMM PF00510; match to protein family HMM TIGR02842 GB:PROTEIN_ID ACF69208.1 GB:DB_XREF GI:194408989 GB:GENE:GENE cyoC LENGTH 204 SQ:AASEQ MATDTLTHATAHAHEHGHHDAGQNKIFGFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMHKNNKSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM GT:EXON 1|1-204:0| SW:ID CYOC_SHIFL SW:DE RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; EC=1.10.3.-;AltName: Full=Cytochrome o ubiquinol oxidase subunit III;AltName: Full=Ubiquinol oxidase chain C; SW:GN Name=cyoC; OrderedLocusNames=SF0371, S0376; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Electron transport; Membrane; Oxidoreductase; Transmembrane;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 25->204|CYOC_SHIFL|e-102|96.7|180/204| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 5 TM:REGION 29->51| TM:REGION 66->88| TM:REGION 98->120| TM:REGION 140->162| TM:REGION 179->201| SEG 2->22|atdtlthatahahehghhdag| BL:PDB:NREP 1 BL:PDB:REP 25->203|1fftC|e-102|96.6|179/185| RP:PFM:NREP 1 RP:PFM:REP 27->199|PF00510|1e-15|32.4|170/212|COX3| HM:PFM:NREP 1 HM:PFM:REP 16->202|PF00510|4e-21|29.3|184/258|COX3| GO:PFM:NREP 3 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00510|IPR000298| GO:PFM GO:0006123|"GO:mitochondrial electron transport, cytochrome c to oxygen"|PF00510|IPR000298| GO:PFM GO:0016020|"GO:membrane"|PF00510|IPR000298| RP:SCP:NREP 1 RP:SCP:REP 24->203|1fftC|7e-40|96.1|180/185|f.25.1.1| HM:SCP:REP 19->203|1fftC_|1.9e-59|39.5|185/185|f.25.1.1|1/1|Cytochrome c oxidase subunit III-like| OP:NHOMO 904 OP:NHOMOORG 620 OP:PATTERN 11----1111111111----1---21111111------------------------------------ 1221111111111122111-141111111111222311111111111111112111111111111121111------------1---------------------111-2--------------11-------------11---11132111111--21212221115341111111112112--------22222222222222222222222222212232111111113211111111111111111111--------------------------------------------------------------------------------------------------1---------------------1--122111111-153443-1122122332333333-2232232233113112332333331-1-111112111211111111122212-1-11111111--11111111111111-1111111-2-133343222231233211143333123314655113342122211213-32121211--------12-1-41-----11-1---1-1-----1--121111---------------------------111112115122111222221222221122121--11-111111111111111111111111-1111111111111111111111111111111111111111111111-111111111111111111111111111121-12-11---------------1111111---1122222322122222111-11111111-1--3-----221113322222222111111----1111-----------------------------------------------2- ---------------------------------111------------------111--------11--------------------------1----------11------1-111-----1-2--1-11--11-----1--11--------1-1----------12--4---11------------------2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 87.7 SQ:SECSTR ########################HHHHHHTTHHHHTTHHHHHHHHHTTTTTTccccccccccTTHHHHHHHHHHHGGGTTTTTcGGGTTTTccGGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccTTTHHHHHHHHHTTHHHHTTHHHHHHHHHHHHTcccTTcccHHHHHHHHHHHHHHHHHHHccccccccc# DISOP:02AL 1-14| PSIPRED ccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //