[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cyoD
DDBJ      :cyoD         cytochrome o ubiquinol oxidase, subunit IV
Swiss-Prot:CYOD_SHIFL   RecName: Full=Cytochrome o ubiquinol oxidase protein cyoD;         Short=Ubiquinol oxidase chain D;

Homologs  Archaea  0/68 : Bacteria  258/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->100 PF03626 * COX4_pro 1e-16 63.9 %
:HMM:PFM   18->100 PF03626 * COX4_pro 3.3e-36 53.0 83/83  
:BLT:SWISS 1->109 CYOD_SHIFL 5e-58 93.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69111.1 GT:GENE cyoD GT:PRODUCT cytochrome o ubiquinol oxidase, subunit IV GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(541379..541708) GB:FROM 541379 GB:TO 541708 GB:DIRECTION - GB:GENE cyoD GB:PRODUCT cytochrome o ubiquinol oxidase, subunit IV GB:NOTE identified by match to protein family HMM PF03626; match to protein family HMM TIGR02847 GB:PROTEIN_ID ACF69111.1 GB:DB_XREF GI:194408892 GB:GENE:GENE cyoD LENGTH 109 SQ:AASEQ MSHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAASPAVILGSILAMAVVQILVHLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYNMMMH GT:EXON 1|1-109:0| SW:ID CYOD_SHIFL SW:DE RecName: Full=Cytochrome o ubiquinol oxidase protein cyoD; Short=Ubiquinol oxidase chain D; SW:GN Name=cyoD; OrderedLocusNames=SF0370, S0375; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Electron transport; Membrane; Oxidoreductase; Transmembrane;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->109|CYOD_SHIFL|5e-58|93.6|109/109| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 17->39| TM:REGION 46->67| TM:REGION 81->103| RP:PFM:NREP 1 RP:PFM:REP 18->100|PF03626|1e-16|63.9|83/83|COX4_pro| HM:PFM:NREP 1 HM:PFM:REP 18->100|PF03626|3.3e-36|53.0|83/83|COX4_pro| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03626|IPR005171| OP:NHOMO 290 OP:NHOMOORG 260 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------11-11111--112-----11-11111111111-11111111-1-11111111111111------1-----1-11111111-1111------------------------------------1-122211111111222211122222121212333--222-11111---1-11--1--1-----------------------1-------------------------------------------------1111----11---111-1-11111--11-1-------------11111111111111111-1111111111111111111111111111111111111111111111-11111-11-111111111111-11-11-1---1-11---------------1111111-----11111211-1111-111----------1--------11---22111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13,15-15,109-110| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHcc //