[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cyoE
DDBJ      :cyoE         protoheme IX farnesyltransferase
Swiss-Prot:CYOE_SALTY   RecName: Full=Protoheme IX farnesyltransferase;         EC=2.5.1.-;AltName: Full=Heme O synthase;AltName: Full=Heme B farnesyltransferase;

Homologs  Archaea  29/68 : Bacteria  591/915 : Eukaryota  142/199 : Viruses  0/175   --->[See Alignment]
:295 amino acids
:PSIPRED
:RPS:PFM   18->225 PF01040 * UbiA 4e-18 35.9 %
:HMM:PFM   18->270 PF01040 * UbiA 1.5e-37 29.8 242/258  
:BLT:SWISS 1->295 CYOE_SALTY e-158 100.0 %
:PROS 155->166|PS00141|ASP_PROTEASE
:PROS 56->78|PS00943|UBIA
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70271.1 GT:GENE cyoE GT:PRODUCT protoheme IX farnesyltransferase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(540477..541364) GB:FROM 540477 GB:TO 541364 GB:DIRECTION - GB:GENE cyoE GB:PRODUCT protoheme IX farnesyltransferase GB:NOTE identified by match to protein family HMM PF01040; match to protein family HMM TIGR01473 GB:PROTEIN_ID ACF70271.1 GB:DB_XREF GI:194410052 GB:GENE:GENE cyoE LENGTH 295 SQ:AASEQ MFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGVSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFGANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLMLTLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSVDFMVPNSQNLLTYVW GT:EXON 1|1-295:0| SW:ID CYOE_SALTY SW:DE RecName: Full=Protoheme IX farnesyltransferase; EC=2.5.1.-;AltName: Full=Heme O synthase;AltName: Full=Heme B farnesyltransferase; SW:GN Name=cyoE; OrderedLocusNames=STM0439; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Heme biosynthesis; Membrane; Transferase; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->295|CYOE_SALTY|e-158|100.0|295/296| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006783|"GO:heme biosynthetic process"|Heme biosynthesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 155->166|PS00141|ASP_PROTEASE|PDOC00128| PROS 56->78|PS00943|UBIA|PDOC00727| TM:NTM 8 TM:REGION 8->30| TM:REGION 36->58| TM:REGION 76->98| TM:REGION 105->127| TM:REGION 133->155| TM:REGION 161->182| TM:REGION 219->241| TM:REGION 263->285| SEG 112->123|gvmgfvvyvgvy| SEG 234->239|vvaaav| RP:PFM:NREP 1 RP:PFM:REP 18->225|PF01040|4e-18|35.9|206/261|UbiA| HM:PFM:NREP 1 HM:PFM:REP 18->270|PF01040|1.5e-37|29.8|242/258|UbiA| GO:PFM:NREP 2 GO:PFM GO:0004659|"GO:prenyltransferase activity"|PF01040|IPR000537| GO:PFM GO:0016021|"GO:integral to membrane"|PF01040|IPR000537| OP:NHOMO 829 OP:NHOMOORG 762 OP:PATTERN 11---1--11111111-121-11111111122-----------------------------21---12 1111111111111111111-111111111111111111111111111111111111111111111121111------------1-----------------11111111---------------11----------11111---11111111111111111111111112111111111111111111---11211111111211111111111211111121111111112111111111111111111111--------------------------------------------------------------------------------------------------1---1-----------------1-11111111111111122111111-111-111111-1111111112111111111111111111111111111111111111111111-1-111111111111111111111111-111111111-1111111111111111111111111111111111111111111111111111111121-------1111111--------1---------111--11-11----------------------------221112112122111222121222221122121--11-111111111111111111111111-1111111111111111111111111111111111111111111111-11-111111111111111111111111111111111---------------1111111---1122221233211111111-11111111-1--1-----321111111111111111111--111111----------------------------------------------11- 11--111-211-11111111--1111111-11--1-1------111-11-1-11--1-----11111111111111111111111111-12-11-1----121112-1--211111--11-11111111151-121111-1-112-11--1112-111-12121111111-1111111-411--111221111------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcc //