[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cysC
DDBJ      :cysC         adenylylsulfate kinase
Swiss-Prot:CYSC_SALTY   RecName: Full=Adenylyl-sulfate kinase;         EC=2.7.1.25;AltName: Full=APS kinase;AltName: Full=Adenosine-5'-phosphosulfate kinase;AltName: Full=ATP adenosine-5'-phosphosulfate 3'-phosphotransferase;

Homologs  Archaea  13/68 : Bacteria  478/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->184 2ofwG PDBj 1e-47 51.1 %
:RPS:PDB   4->177 2dfsA PDBj 2e-33 15.5 %
:RPS:SCOP  4->163 1b7tA4  c.37.1.9 * 4e-30 15.6 %
:HMM:SCOP  23->201 1x6vA3 c.37.1.4 * 1.7e-33 32.0 %
:RPS:PFM   27->180 PF01583 * APS_kinase 3e-66 70.1 %
:HMM:PFM   27->179 PF01583 * APS_kinase 2e-74 65.4 153/157  
:BLT:SWISS 1->188 CYSC_SALTY e-108 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67706.1 GT:GENE cysC GT:PRODUCT adenylylsulfate kinase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3046956..3047561) GB:FROM 3046956 GB:TO 3047561 GB:DIRECTION - GB:GENE cysC GB:PRODUCT adenylylsulfate kinase GB:NOTE identified by match to protein family HMM PF01583; match to protein family HMM TIGR00455 GB:PROTEIN_ID ACF67706.1 GB:DB_XREF GI:194407487 GB:GENE:GENE cysC LENGTH 201 SQ:AASEQ MALHDENVVWHSHPVTVAAREQLHGHRGVVLWFTGLSGSGKSTVAGALEEALHQRGVSTYLLDGDNVRHGLCRDLGFSDADRQENIRRVGEVASLMADAGLIVLTAFISPHRAERQLVKERVGHDRFIEIYVNTPLAICEQRDPKGLYKKARAGELRNFTGIDAIYEAPDSPQVHLNGEQLVTNLVSQLLDLLRRRDIIRS GT:EXON 1|1-201:0| SW:ID CYSC_SALTY SW:DE RecName: Full=Adenylyl-sulfate kinase; EC=2.7.1.25;AltName: Full=APS kinase;AltName: Full=Adenosine-5'-phosphosulfate kinase;AltName: Full=ATP adenosine-5'-phosphosulfate 3'-phosphotransferase; SW:GN Name=cysC; OrderedLocusNames=STM2933; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->188|CYSC_SALTY|e-108|100.0|188/201| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 189->200|lldllrrrdiir| BL:PDB:NREP 1 BL:PDB:REP 7->184|2ofwG|1e-47|51.1|178/201| RP:PDB:NREP 1 RP:PDB:REP 4->177|2dfsA|2e-33|15.5|174/994| RP:PFM:NREP 1 RP:PFM:REP 27->180|PF01583|3e-66|70.1|154/157|APS_kinase| HM:PFM:NREP 1 HM:PFM:REP 27->179|PF01583|2e-74|65.4|153/157|APS_kinase| GO:PFM:NREP 4 GO:PFM GO:0000103|"GO:sulfate assimilation"|PF01583|IPR002891| GO:PFM GO:0005524|"GO:ATP binding"|PF01583|IPR002891| GO:PFM GO:0016301|"GO:kinase activity"|PF01583|IPR002891| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF01583|IPR002891| RP:SCP:NREP 1 RP:SCP:REP 4->163|1b7tA4|4e-30|15.6|160/718|c.37.1.9| HM:SCP:REP 23->201|1x6vA3|1.7e-33|32.0|175/0|c.37.1.4|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 984 OP:NHOMOORG 669 OP:PATTERN 11-111-------------1-1-1------------------------1-----1----1------11 1-1-2---------22211-11--21111111122223221113---1------------111---12111-----------2111--1111-1-------1--121-1------------------1--121--312211---1-111111111111111111121--12111111111111111-----11111111111111111112111211111111--------11---------------11111-----------11----------------------------------------------------------1-1-------------22------1-----1---2-1-1-1---------121111-----111221111211211111111111-2-1--2-1111----2--1---221111111111111111111111111111111------------------------------11111------11221232331-12334333321121--2--2--1--1---1--1-1---1---------11----11212---11111--213--2-11-2123-2---1-1-1211-1--------1--2222111111-11111111111111111121211--112-1--1111111-111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-111111----1121--------------------------4121113342211122231--1--11---11111111111111--111111211111--2---------------------------------------------1-------11- ----111-------222222232122122222222222221122212222222222212222211111-11111111-1111111111-332222522222-2223--3-23423332221242232325F3-32712223223-22211222322222133211216115111111-1I1113153242431221214 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 93.5 SQ:SECSTR ccccGGGccccHHHHHHHHHHHHHHTccEEEEEEccTTccHHHHHHHHHHHHHTccTTTcTHHHHHHHHHHHHHHHEEEETTEEEEEccEEEEEEEEcTTccEEEEEEEEEccccGGGTcccTccccHHHHHHHHTTTccGGGGTcccTTTcTTcccccTTccHHHHHHHHHHHHTTHHHHHHHHHHH############# DISOP:02AL 1-3,19-20,22-22,200-202| PSIPRED ccccccccEEEEccccHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHcccccEEEEEEcccHHHHHHHcHHHHHHHHHcccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHcccccc //