[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cysD
DDBJ      :cysD         sulfate adenylyltransferase, subunit 2
Swiss-Prot:CYSD_SALTY   RecName: Full=Sulfate adenylyltransferase subunit 2;         EC=2.7.7.4;AltName: Full=Sulfate adenylate transferase;         Short=SAT;AltName: Full=ATP-sulfurylase small subunit;

Homologs  Archaea  2/68 : Bacteria  449/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->212 1zunA PDBj 1e-80 82.4 %
:RPS:PDB   12->294 2dplA PDBj 4e-27 13.7 %
:RPS:SCOP  5->212 1zunA1  c.26.2.2 * 3e-81 79.4 %
:HMM:SCOP  2->210 1zunA1 c.26.2.2 * 2e-71 43.1 %
:RPS:PFM   30->216 PF01507 * PAPS_reduct 4e-41 53.7 %
:HMM:PFM   29->257 PF01507 * PAPS_reduct 7e-69 51.8 170/174  
:BLT:SWISS 1->302 CYSD_SALTY e-180 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68693.1 GT:GENE cysD GT:PRODUCT sulfate adenylyltransferase, subunit 2 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3048997..3049905) GB:FROM 3048997 GB:TO 3049905 GB:DIRECTION - GB:GENE cysD GB:PRODUCT sulfate adenylyltransferase, subunit 2 GB:NOTE identified by match to protein family HMM PF01507; match to protein family HMM TIGR02039 GB:PROTEIN_ID ACF68693.1 GB:DB_XREF GI:194408474 GB:GENE:GENE cysD LENGTH 302 SQ:AASEQ MDQKRLTHLRQLEAESIHIIREVAAEFANPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYAFRDRTANAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWRNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMVDDDRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESHAQTLPEIIEEMLVSTTSERQGRMIDRDQAGSMELKKRQGYF GT:EXON 1|1-302:0| SW:ID CYSD_SALTY SW:DE RecName: Full=Sulfate adenylyltransferase subunit 2; EC=2.7.7.4;AltName: Full=Sulfate adenylate transferase; Short=SAT;AltName: Full=ATP-sulfurylase small subunit; SW:GN Name=cysD; OrderedLocusNames=STM2935; SW:KW ATP-binding; Complete proteome; Nucleotide-binding;Nucleotidyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->302|CYSD_SALTY|e-180|100.0|302/302| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 5->212|1zunA|1e-80|82.4|187/196| RP:PDB:NREP 1 RP:PDB:REP 12->294|2dplA|4e-27|13.7|278/287| RP:PFM:NREP 1 RP:PFM:REP 30->216|PF01507|4e-41|53.7|162/175|PAPS_reduct| HM:PFM:NREP 1 HM:PFM:REP 29->257|PF01507|7e-69|51.8|170/174|PAPS_reduct| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01507|IPR002500| GO:PFM GO:0016740|"GO:transferase activity"|PF01507|IPR002500| RP:SCP:NREP 1 RP:SCP:REP 5->212|1zunA1|3e-81|79.4|194/197|c.26.2.2| HM:SCP:REP 2->210|1zunA1|2e-71|43.1|209/0|c.26.2.2|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 516 OP:NHOMOORG 453 OP:PATTERN --------1-------1--------------------------------------------------- 111-31-111111131111-11--11111111122234331112---11---111111--111-1122111-----------------111111------11-1111111---------------------11--2------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------11-11------------11----1-1---111111-----------1--1--11111-----111221111211211111111111-11111111111-11121121113311111--1-------1111111111111111------------------------------11111-111111121112222111122232222122211111111111111111111-11111--21111111111------1---1----2212112111-111---1-------------------11--1221111211-11111111111111111121211--121----1111111-111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1---------1-12111-1-1---------1111111---1111111211111111111-----1----11111111111111--111111112121--1-111111----------------------------------------------121 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 297 STR:RPRED 98.3 SQ:SECSTR HHHHHHHcHHHHHHHHHHHHHHHHHHHTTcEEEccccHHHHHHHHHHHHHHGGEEEGEEEEEEEccccTTHHHHHHHHHTTTTccEEEEEEcHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHTccEEEcccccccccEEEcTTTTccHHHHHHHHHHTTccHHHHTcccccTTGGGGGccccccHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEccccEEEEccccEEEEEEEEEEHHEEEcccccccEEccccHHHHHHHHHHHHHHcTTEEEEEEcccccTTccccHHH##### DISOP:02AL 1-3,285-286,289-289,291-292| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHccEEEEEEcHHHHHHccccccccHHHHcHHHHHHHHHHHHHHHcccEEEEEEEHHHcccccccccEEEccccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHcccccccHHHcccccccccccccccccccccccccccHHHHccccccccccccccccccccccHHHHHHHHHHcccccHHHHccccccHHHHHHHHHcccc //