[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cysH
DDBJ      :cysH         phosphoadenosine phosphosulfate reductase
Swiss-Prot:CYSH_SALHS   RecName: Full=Phosphoadenosine phosphosulfate reductase;         EC=1.8.4.8;AltName: Full=PAPS reductase, thioredoxin dependent;AltName: Full=PAdoPS reductase;AltName: Full=3'-phosphoadenylylsulfate reductase;AltName: Full=PAPS sulfotransferase;

Homologs  Archaea  17/68 : Bacteria  521/915 : Eukaryota  114/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:244 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->244 2o8vA PDBj e-123 93.4 %
:RPS:PDB   24->244 3dlaB PDBj 2e-21 8.5 %
:RPS:SCOP  2->216 1surA  c.26.2.2 * 4e-67 93.0 %
:HMM:SCOP  2->216 1surA_ c.26.2.2 * 5.4e-54 37.2 %
:RPS:PFM   49->213 PF01507 * PAPS_reduct 2e-32 45.9 %
:HMM:PFM   48->219 PF01507 * PAPS_reduct 4.8e-55 38.0 166/174  
:HMM:PFM   12->31 PF12390 * Se-cys_synth_N 0.0003 35.0 20/40  
:BLT:SWISS 1->244 CYSH_SALHS e-144 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70462.1 GT:GENE cysH GT:PRODUCT phosphoadenosine phosphosulfate reductase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(3063045..3063779) GB:FROM 3063045 GB:TO 3063779 GB:DIRECTION - GB:GENE cysH GB:PRODUCT phosphoadenosine phosphosulfate reductase GB:NOTE identified by match to protein family HMM PF01507; match to protein family HMM TIGR00434; match to protein family HMM TIGR02057 GB:PROTEIN_ID ACF70462.1 GB:DB_XREF GI:194410243 GB:GENE:GENE cysH LENGTH 244 SQ:AASEQ MSQLDLNALNELPKVDRVLALAETNAQLETLTAEERVAWALENLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDKLKLNLKVYRAGESPAWQEARYGKLWEQGVEGIEKYNEINKVEPMNRALKELKAQTWFAGLRREQSGSRAHLPVLAIQRGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLWDQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG GT:EXON 1|1-244:0| SW:ID CYSH_SALHS SW:DE RecName: Full=Phosphoadenosine phosphosulfate reductase; EC=1.8.4.8;AltName: Full=PAPS reductase, thioredoxin dependent;AltName: Full=PAdoPS reductase;AltName: Full=3'-phosphoadenylylsulfate reductase;AltName: Full=PAPS sulfotransferase; SW:GN Name=cysH; OrderedLocusNames=SeHA_C3141; SW:KW Complete proteome; Cytoplasm; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->244|CYSH_SALHS|e-144|100.0|244/244| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 2->244|2o8vA|e-123|93.4|229/229| RP:PDB:NREP 1 RP:PDB:REP 24->244|3dlaB|2e-21|8.5|212/649| RP:PFM:NREP 1 RP:PFM:REP 49->213|PF01507|2e-32|45.9|159/175|PAPS_reduct| HM:PFM:NREP 2 HM:PFM:REP 48->219|PF01507|4.8e-55|38.0|166/174|PAPS_reduct| HM:PFM:REP 12->31|PF12390|0.0003|35.0|20/40|Se-cys_synth_N| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01507|IPR002500| GO:PFM GO:0016740|"GO:transferase activity"|PF01507|IPR002500| RP:SCP:NREP 1 RP:SCP:REP 2->216|1surA|4e-67|93.0|215/215|c.26.2.2| HM:SCP:REP 2->216|1surA_|5.4e-54|37.2|215/0|c.26.2.2|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 687 OP:NHOMOORG 652 OP:PATTERN ------1111111111--1----------------1-1----1-1---------------------11 111-11-111111112211-11--21111112111112111111----1---111111--114-1111111-----------1--1------1-------11-1111111----------------------1----1111---1-211211111111111111111111111111111111111111---11111111111111111111221211111111--------21---------------11111-----------------------------------------------------------------------------------------------1--1----11-----------------11111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111------------------------------11111-11-111111111111111111111111111111111111111111111111-11111--21111111111------1----11--111-1111-1-111---1-------------------11---111111111-11111111111111111111111--121----1111111-111111111111-1111111111111111111111111111111111111-11111111111111-1---122-211111-1-1--1----1121111-1-1---------11111111111111111111111111111----------11111111111111--111111111111----111111----------------------------------------------111 ------1-------111111111111111111111111111111111111111111111111111111-1111-11111111111111-111111111111-1112--1------------------------------------------------------1-----------111-81111221111311211111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 99.6 SQ:SECSTR #ccccHHHHHHHTTccccccHHcHHHHHHHHHHHHHHHHHHHTTccEEEEEccccHHHHHHHHHHHHHHHHTTccGGGEEEEEccccHHHHHHHHHHTcEEEEcccHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHTEEEEEcccHHHHHHHHHTcccccccTTcccEEccTTccHHHHHHHHHHHHHHcTTHHHHHHHHHHHHHHcccTTcccHHHHHHHHHHHHHHcccHH DISOP:02AL 1-1,244-245| PSIPRED ccHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHcccEEEccccEEEEEEcccccHHHHHHHHHHHccccccHHHccccccccccccccccccccHHHHcccccccccccccc //