[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cysK
DDBJ      :cysK         cysteine synthase A
Swiss-Prot:CYSK_SALTY   RecName: Full=Cysteine synthase A;         Short=CSase A;         EC=2.5.1.47;AltName: Full=O-acetylserine sulfhydrylase A;AltName: Full=O-acetylserine (thiol)-lyase A;         Short=OAS-TL A;

Homologs  Archaea  42/68 : Bacteria  803/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:323 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->323 1d6sA PDBj e-163 99.4 %
:RPS:PDB   2->323 1d6sA PDBj 3e-72 91.0 %
:RPS:SCOP  2->323 1d6sA  c.79.1.1 * e-127 91.0 %
:HMM:SCOP  2->303 1fcjA_ c.79.1.1 * 1.6e-95 39.7 %
:RPS:PFM   9->301 PF00291 * PALP 7e-28 38.8 %
:HMM:PFM   9->300 PF00291 * PALP 1.9e-65 35.3 272/297  
:BLT:SWISS 1->323 CYSK_SALTY e-164 100.0 %
:PROS 31->49|PS00901|CYS_SYNTHASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66982.1 GT:GENE cysK GT:PRODUCT cysteine synthase A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2601182..2602153 GB:FROM 2601182 GB:TO 2602153 GB:DIRECTION + GB:GENE cysK GB:PRODUCT cysteine synthase A GB:NOTE identified by match to protein family HMM PF00291; match to protein family HMM TIGR01136; match to protein family HMM TIGR01139 GB:PROTEIN_ID ACF66982.1 GB:DB_XREF GI:194406763 GB:GENE:GENE cysK LENGTH 323 SQ:AASEQ MSKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPGNLDLKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ GT:EXON 1|1-323:0| SW:ID CYSK_SALTY SW:DE RecName: Full=Cysteine synthase A; Short=CSase A; EC=2.5.1.47;AltName: Full=O-acetylserine sulfhydrylase A;AltName: Full=O-acetylserine (thiol)-lyase A; Short=OAS-TL A; SW:GN Name=cysK; OrderedLocusNames=STM2430; SW:KW 3D-structure; Allosteric enzyme; Amino-acid biosynthesis;Complete proteome; Cysteine biosynthesis; Direct protein sequencing;Pyridoxal phosphate; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->323|CYSK_SALTY|e-164|100.0|323/323| GO:SWS:NREP 3 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0019344|"GO:cysteine biosynthetic process"|Cysteine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 31->49|PS00901|CYS_SYNTHASE|PDOC00700| SEG 175->186|gvgtggtltgvt| SEG 268->282|ilagissgaavaaal| BL:PDB:NREP 1 BL:PDB:REP 2->323|1d6sA|e-163|99.4|322/322| RP:PDB:NREP 1 RP:PDB:REP 2->323|1d6sA|3e-72|91.0|322/322| RP:PFM:NREP 1 RP:PFM:REP 9->301|PF00291|7e-28|38.8|281/293|PALP| HM:PFM:NREP 1 HM:PFM:REP 9->300|PF00291|1.9e-65|35.3|272/297|PALP| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00291|IPR001926| GO:PFM GO:0008152|"GO:metabolic process"|PF00291|IPR001926| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00291|IPR001926| RP:SCP:NREP 1 RP:SCP:REP 2->323|1d6sA|e-127|91.0|322/323|c.79.1.1| HM:SCP:REP 2->303|1fcjA_|1.6e-95|39.7|302/302|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 2317 OP:NHOMOORG 1026 OP:PATTERN 111122--111111112-------2222133211--------132-11-111---1--1122111--1 4232221222222122233-33223233233333335234143212212221333122--533222452321111-11-2124111112221-1-----32423321133---------------2222232332222222111313224224222422222222225542222222222222211111111333333333333333433233333333331322111111552333333333333322222222-21122-2-112212-2--1122211111111111111111111111111111111111112221111243233333333332223312222121-12231213222131232211213133223-----222232223432313222222123122222323152-4222224222222224321122222122222222222222323-----------------------------1222221111122212221111111211121121234331211322222233222112112232111111112222332311221132111-232232342555549322111111111112111111121111112211221221112222212222212222211--22211--11133422332222222222-2222222222222222222343335432222222222222222422222222-33332332332211-31111111112233211111111111111122222221112243333234222222533211111111111112222211111222222222222221121333322------------------------------------1212211111122 ----234-421-2243333323334323322223333555555322334633643433333333333323223332212233333322-35333333333233444-4F23222421111111133-216C1-222-11-1111--11--21-2-121113424222222159343444r444655BFG3F53497666 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 323 STR:RPRED 100.0 SQ:SECSTR cccccccGGGGcccccEEEccccTTccEEEEETTccTTccTTHHHHHHHHHHHHHTTcccTTcEEEEEcccHHHHHHHHHHHHHTccEEEEEETTccHHHHHHHHHTTcEEEEEcGGGHHHHHHHHHHHHHHHcTTTEEEccTTTcTHHHHHHHHTHHHHHHHHTTTcccEEEEEccccHHHHHHHHHHHTTcccTTcEEEEEEETTccHHHHHHTTccccccccccTTcccccccTTccGGGccEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHTTcGGGTTccEEEEEcccGGGGTTcHHHHTTccHHHHcc DISOP:02AL 1-1,323-324| PSIPRED cccHHHHHHHccccccEEEcccccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHcccccccccEEEccccccccHHHHHHHccEEEEEcHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHccccccEEEEEEcccccccccHHHcHHHHHHccccc //