[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cysP
DDBJ      :cysP         sulfate/thiosulfate ABC transporter, periplasmic sulfate/thiosulfate-binding protein
Swiss-Prot:CYSP_SALTY   RecName: Full=Thiosulfate-binding protein;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  375/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->332 1sbpA PDBj 5e-69 42.1 %
:RPS:PDB   29->327 1d9yA PDBj 1e-23 11.2 %
:RPS:SCOP  27->332 1sbpA  c.94.1.1 * e-110 44.4 %
:HMM:SCOP  24->334 1sbpA_ c.94.1.1 * 3.1e-80 32.4 %
:HMM:PFM   37->277 PF01547 * SBP_bac_1 3.8e-22 26.3 232/314  
:HMM:PFM   9->28 PF12477 * TraW_N 0.00028 50.0 20/31  
:BLT:SWISS 1->338 CYSP_SALTY e-177 99.7 %
:PROS 41->47|PS00092|N6_MTASE
:PROS 53->65|PS00401|PROK_SULFATE_BIND_1
:PROS 151->159|PS00757|PROK_SULFATE_BIND_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66939.1 GT:GENE cysP GT:PRODUCT sulfate/thiosulfate ABC transporter, periplasmic sulfate/thiosulfate-binding protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2613656..2614672) GB:FROM 2613656 GB:TO 2614672 GB:DIRECTION - GB:GENE cysP GB:PRODUCT sulfate/thiosulfate ABC transporter, periplasmic sulfate/thiosulfate-binding protein GB:NOTE identified by match to protein family HMM PF01547; match to protein family HMM TIGR00971 GB:PROTEIN_ID ACF66939.1 GB:DB_XREF GI:194406720 GB:GENE:GENE cysP LENGTH 338 SQ:AASEQ MAVNLLKKRPLTLAAMLLLAGQAQATELLNSSYDVSRELFAALNPPFEQQWAKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWSDLVRSDVKLIFPNPKTSGNARYTYLAAWGAADNADGGDKAKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIITHYYYRVNNPEIMGKQADKFPQTELFRVEDKFGSWPEVMKTHFASGGELDKLLAAGRK GT:EXON 1|1-338:0| SW:ID CYSP_SALTY SW:DE RecName: Full=Thiosulfate-binding protein;Flags: Precursor; SW:GN Name=cysP; OrderedLocusNames=STM2444; SW:KW Complete proteome; Periplasm; Signal; Sulfate transport; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->338|CYSP_SALTY|e-177|99.7|338/338| GO:SWS:NREP 3 GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| GO:SWS GO:0008272|"GO:sulfate transport"|Sulfate transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 41->47|PS00092|N6_MTASE|PDOC00087| PROS 53->65|PS00401|PROK_SULFATE_BIND_1|PDOC00337| PROS 151->159|PS00757|PROK_SULFATE_BIND_2|PDOC00337| SEG 11->26|ltlaamlllagqaqat| SEG 164->178|aawgaadnadggdka| BL:PDB:NREP 1 BL:PDB:REP 27->332|1sbpA|5e-69|42.1|304/309| RP:PDB:NREP 1 RP:PDB:REP 29->327|1d9yA|1e-23|11.2|286/309| HM:PFM:NREP 2 HM:PFM:REP 37->277|PF01547|3.8e-22|26.3|232/314|SBP_bac_1| HM:PFM:REP 9->28|PF12477|0.00028|50.0|20/31|TraW_N| RP:SCP:NREP 1 RP:SCP:REP 27->332|1sbpA|e-110|44.4|304/309|c.94.1.1| HM:SCP:REP 24->334|1sbpA_|3.1e-80|32.4|309/309|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 593 OP:NHOMOORG 380 OP:PATTERN -------------------------------------------------------------------- --------------21111-11111111111111111111--------1-------------1---------------------------------------------------------------------11----------1--1121131133------1111312---------------------1-------21-----1--11------1---1---------12----------------------------------------------------------------------------------------------2------------11----1-1---111-11--------------1---1111-----221111111222222222222222-11111111-21-12211121112222-----22322-1-11111111-11-1212------------------------------------11122222222111122222222222221111--11112222232222223-22212-211111113132---------------12--111--1-2111--1--------------------------111-1-------1111---1112-2--2--1------------2211-222222222222-2222222222222222222222222222222222222222222222222222-22222222222211-----------1---21111-1---------22222222222222222222222221222--------------12222---1---111111111111----112222-----------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----11-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 309 STR:RPRED 91.4 SQ:SECSTR ##########################cEEEEEEcccHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHGGGccccEEEEccHHHHHHHHHTTcccccccTTHHHHTccTEEEEEEEEEETcGGGccccGGGGccGGGTTTEEEcTTcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcEEcccHHHHHHHHHHHTTcccEEEEETHHHHHHHHHHcGGGccEEEEcccTTcGGGcEEEEEEEEcTTccHHHHHHHHHHHcHHHHHHHHcccEEccTTcccccccccHHHHTccccccccHHHHHHHHHHHHHHTHHHHHHHH### DISOP:02AL 1-6,336-339| PSIPRED cccHHHHHHHHHHHHHHHHccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHccccccEEEEccHHHHHHHHHccccccccHHHHcccccccccEEEEEEEEcccccccccHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEEcccccHHHHHHHHcccccEEEEccHHHHHHHHHcccccEEEEEcccccEEcccEEEEEccccccccHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHccccEEEEHHHHcccHHHHHHHHHHcccEEHHHHccccc //