[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cysT
DDBJ      :cysT         sulfate ABC transporter, permease protein CysT
Swiss-Prot:CYST_SALTY   RecName: Full=Sulfate transport system permease protein cysT;

Homologs  Archaea  59/68 : Bacteria  747/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:277 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->219 2onkC PDBj 3e-25 31.7 %
:RPS:PDB   165->204 3dhwA PDBj 1e-13 37.5 %
:RPS:SCOP  44->243 2r6gG1  f.58.1.1 * 6e-27 22.8 %
:RPS:PFM   93->212 PF00528 * BPD_transp_1 1e-11 37.3 %
:HMM:PFM   76->274 PF00528 * BPD_transp_1 4.8e-35 27.8 180/185  
:BLT:SWISS 1->277 CYST_SALTY e-133 99.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67342.1 GT:GENE cysT GT:PRODUCT sulfate ABC transporter, permease protein CysT GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2612823..2613656) GB:FROM 2612823 GB:TO 2613656 GB:DIRECTION - GB:GENE cysT GB:PRODUCT sulfate ABC transporter, permease protein CysT GB:NOTE identified by match to protein family HMM PF00528; match to protein family HMM TIGR00969; match to protein family HMM TIGR02139 GB:PROTEIN_ID ACF67342.1 GB:DB_XREF GI:194407123 GB:GENE:GENE cysT LENGTH 277 SQ:AASEQ MLAVSSRRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLSQMSWSQYWDVVTNPQVVAAYKVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAGLTLASLFSVNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEEAAQTLGATRLQSFRKVVLPELSPALIAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEFDYPAASAIASVILAASLLLLFSINTLQSRFGRRVVGH GT:EXON 1|1-277:0| SW:ID CYST_SALTY SW:DE RecName: Full=Sulfate transport system permease protein cysT; SW:GN Name=cysU; Synonyms=cysT; OrderedLocusNames=STM2443; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Sulfate transport; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->277|CYST_SALTY|e-133|99.6|277/277| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008272|"GO:sulfate transport"|Sulfate transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 6 TM:REGION 16->38| TM:REGION 59->81| TM:REGION 96->118| TM:REGION 140->162| TM:REGION 196->218| TM:REGION 236->258| SEG 21->32|llfvclilllpl| SEG 244->263|aasaiasvilaasllllfsi| BL:PDB:NREP 1 BL:PDB:REP 34->219|2onkC|3e-25|31.7|183/252| RP:PDB:NREP 1 RP:PDB:REP 165->204|3dhwA|1e-13|37.5|40/203| RP:PFM:NREP 1 RP:PFM:REP 93->212|PF00528|1e-11|37.3|118/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 76->274|PF00528|4.8e-35|27.8|180/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 44->243|2r6gG1|6e-27|22.8|193/284|f.58.1.1| OP:NHOMO 3188 OP:NHOMOORG 815 OP:PATTERN 11113111111111112--1---22234422121321377753131741153322424423-111--- -12-51223341-343333-35--3533333354444555122222225221223312--1141323223211111112132311111112312--------1--2-11----------------2213333532324433--162255333334551----133334551--11-----11-2121122-31144434664344464485441144625352-122222289111111111111111111116-21221-1-111222222-211111333-11--11122211111111---------1--111222111-133255554465253353314547142372462553322-212211213211-4333-11-133CAD43747576AACCACC8CCG-443334457E4-CIIB98EDDBGHFA1-117GABBBA6333333333133-2549-----------------------------1-212-58856B9AB8C54555DDEE665635BDE7367-25666333344B74B67A1333573444444324354-292435321A443153214446-42344223322111111-2-111111111331111335262513-325555234555737447232-1132-------77844B45885566656-8655667666866555656787CC5587767777776787877766645553-85554555555522-2---------4251A666877234234445333232346466887766AAA79775BBB122122222144456666634342223333333322221-13332222-11------11111----------------------253--2323115- -------------1------------------------------------------------------------------------------------------------------------------------------------------------2----1-----------222-----12---1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 74.7 SQ:SECSTR #################################HHHHHTTTTTHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcTTcTTTTTGTTcccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHccHHHHTTcccGGGccHHHHGGGGcccccc##################################### DISOP:02AL 1-6,8-8,274-278| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //