[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : cysW
DDBJ      :cysW         sulfate ABC transporter, permease protein CysW
Swiss-Prot:CYSW_ECOLI   RecName: Full=Sulfate transport system permease protein cysW;

Homologs  Archaea  54/68 : Bacteria  652/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:291 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   54->225 2onkC PDBj 9e-21 30.2 %
:RPS:PDB   178->210 3dhwA PDBj 3e-08 33.3 %
:RPS:SCOP  58->247 2r6gG1  f.58.1.1 * 5e-25 24.0 %
:RPS:PFM   74->249 PF00528 * BPD_transp_1 6e-08 35.4 %
:HMM:PFM   81->275 PF00528 * BPD_transp_1 6.5e-19 23.9 176/185  
:HMM:PFM   3->94 PF06472 * ABC_membrane_2 0.00035 18.0 89/282  
:BLT:SWISS 1->291 CYSW_ECOLI e-152 97.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68008.1 GT:GENE cysW GT:PRODUCT sulfate ABC transporter, permease protein CysW GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2611948..2612823) GB:FROM 2611948 GB:TO 2612823 GB:DIRECTION - GB:GENE cysW GB:PRODUCT sulfate ABC transporter, permease protein CysW GB:NOTE identified by match to protein family HMM PF00528; match to protein family HMM TIGR00969; match to protein family HMM TIGR02140 GB:PROTEIN_ID ACF68008.1 GB:DB_XREF GI:194407789 GB:GENE:GENE cysW LENGTH 291 SQ:AASEQ MAEVTQLKRYDVPRINWGKWFLIGVGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADPDMLHAIWLTVLIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLDEHNLQMMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQKKRAQQEENHEH GT:EXON 1|1-291:0| SW:ID CYSW_ECOLI SW:DE RecName: Full=Sulfate transport system permease protein cysW; SW:GN Name=cysW; OrderedLocusNames=b2423, JW2416; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Sulfate transport; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->291|CYSW_ECOLI|e-152|97.3|291/291| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008272|"GO:sulfate transport"|Sulfate transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 6 TM:REGION 20->42| TM:REGION 67->89| TM:REGION 102->124| TM:REGION 147->169| TM:REGION 201->223| TM:REGION 249->271| SEG 252->268|ftaaalltlmaiitlfl| BL:PDB:NREP 1 BL:PDB:REP 54->225|2onkC|9e-21|30.2|169/252| RP:PDB:NREP 1 RP:PDB:REP 178->210|3dhwA|3e-08|33.3|33/203| RP:PFM:NREP 1 RP:PFM:REP 74->249|PF00528|6e-08|35.4|164/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 81->275|PF00528|6.5e-19|23.9|176/185|BPD_transp_1| HM:PFM:REP 3->94|PF06472|0.00035|18.0|89/282|ABC_membrane_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 58->247|2r6gG1|5e-25|24.0|183/284|f.58.1.1| OP:NHOMO 2320 OP:NHOMOORG 713 OP:PATTERN --112111111111111--111-1223421421-21125555313164-1432-2324412---1--- -11-11-11121-243333-33--433333333444454411113422311-3241-3--1131211142111111---1122-1111----11-----------1-11----------------1212212321211122--16224323332255--1-1133244541------------231241--5-122222443432342343221134514341-211111186-111111111111113111111-------1------------------------11---1-------------------------------221322211311121244-1324-21132351442-2212-12212-12-1-3333-----33687337345556666666766C-4453324324418996665967A8981--22C687743122222222-33-2544-------------------------------112-4874577766843444998855553566A7435-2776332334389577881333462333333322353-2425323115223-53213356-2-324222312111111-1-111111111231111433231-111-26666123766728337332---32-------53642534665455555-6545556555655445545667874435455555554555555555545552-47767777777722-2---------4152733351411111222433323234444555555576767754656---------13333555553435322333333332222--1-222222--------1----1----------------------143--1223114- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------222-----12---1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 66.3 SQ:SECSTR #####################################################HHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcTTcTTTTTGTTcccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHccHHHHTTcccGGGccHHHHGGGGcccccc############################################# DISOP:02AL 1-2,4-7,273-292| PSIPRED ccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //