[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : dkgB
DDBJ      :dkgB         2,5-didehydrogluconate reductase B
Swiss-Prot:DKGB_SALTY   RecName: Full=2,5-diketo-D-gluconic acid reductase B;         Short=2,5-DKG reductase B;         Short=2,5-DKGR B;         Short=25DKGR-B;         EC=1.1.1.274;AltName: Full=AKR5D;

Homologs  Archaea  42/68 : Bacteria  597/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.1.7
:274 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->263 1mzrB PDBj 3e-48 39.4 %
:RPS:PDB   5->264 3b3dB PDBj 1e-62 36.7 %
:RPS:SCOP  6->273 1a80A  c.1.7.1 * 4e-58 39.6 %
:HMM:SCOP  1->266 1cwnA_ c.1.7.1 * 4e-80 40.4 %
:RPS:PFM   12->250 PF00248 * Aldo_ket_red 2e-36 40.8 %
:HMM:PFM   13->257 PF00248 * Aldo_ket_red 1.9e-59 36.0 242/284  
:BLT:SWISS 8->274 DKGB_SALTY e-148 98.1 %
:PROS 121->138|PS00062|ALDOKETO_REDUCTASE_2
:PROS 36->53|PS00798|ALDOKETO_REDUCTASE_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66558.1 GT:GENE dkgB GT:PRODUCT 2,5-didehydrogluconate reductase B GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 302815..303639 GB:FROM 302815 GB:TO 303639 GB:DIRECTION + GB:GENE dkgB GB:PRODUCT 2,5-didehydrogluconate reductase B GB:NOTE identified by match to protein family HMM PF00248 GB:PROTEIN_ID ACF66558.1 GB:DB_XREF GI:194406339 GB:GENE:GENE dkgB LENGTH 274 SQ:AASEQ MIKKRNSMTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQIYDNEAAVGQAITESGVPRSELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSPGDAVSVEEFMLALLEAKKQGLTREIGISNFTIPLMKKAIAAVGADNIATNQIELSPYLQNRKVVDWAKAHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSSTRRENLASNLLAQDLHLDAEDKNAIAALDCNDRLVSPEGLAPAWD GT:EXON 1|1-274:0| SW:ID DKGB_SALTY SW:DE RecName: Full=2,5-diketo-D-gluconic acid reductase B; Short=2,5-DKG reductase B; Short=2,5-DKGR B; Short=25DKGR-B; EC=1.1.1.274;AltName: Full=AKR5D; SW:GN Name=dkgB; OrderedLocusNames=STM0255; SW:KW Ascorbate biosynthesis; Complete proteome; Cytoplasm; NADP;Oxidoreductase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 8->274|DKGB_SALTY|e-148|98.1|267/267| GO:SWS:NREP 4 GO:SWS GO:0019853|"GO:L-ascorbic acid biosynthetic process"|Ascorbate biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 121->138|PS00062|ALDOKETO_REDUCTASE_2|PDOC00061| PROS 36->53|PS00798|ALDOKETO_REDUCTASE_1|PDOC00061| BL:PDB:NREP 1 BL:PDB:REP 1->263|1mzrB|3e-48|39.4|259/276| RP:PDB:NREP 1 RP:PDB:REP 5->264|3b3dB|1e-62|36.7|256/277| RP:PFM:NREP 1 RP:PFM:REP 12->250|PF00248|2e-36|40.8|238/281|Aldo_ket_red| HM:PFM:NREP 1 HM:PFM:REP 13->257|PF00248|1.9e-59|36.0|242/284|Aldo_ket_red| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00248|IPR001395| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00248|IPR001395| RP:SCP:NREP 1 RP:SCP:REP 6->273|1a80A|4e-58|39.6|265/277|c.1.7.1| HM:SCP:REP 1->266|1cwnA_|4e-80|40.4|265/0|c.1.7.1|1/1|NAD(P)-linked oxidoreductase| OP:NHOMO 4168 OP:NHOMOORG 832 OP:PATTERN 11212112444434522844413-82272761----------------------11111122213--- 354-521344525126511-13111311111135451644-4269572175-878212111-3331946413344443-1112---1-421--------112-317-21----------------1-1111--1-111121---2-113211222-----1--21114241------------221--21-4276666665645655564444575552343656666666581555555555555554333637B36734435888888268478455222211113322222222222111-11111111121111111131--2311122122132-------2-11-222--11-----2--11--2-11--211------324331-33233211111111114-2242552443--9773855A97453311--11212211-3333333316441--1------------------------------211-4-443354444451-1144641112123462322--332-12--1-1-4-13-----1------------1------1----1----2-11--1--123129-1--3---------3------------11223223--31-11111-1-21-11--1--1--1----------45441545776576766-6456665565776555556778221224354656555555556445444551-344444434444-----1-1-----11242---6-4---------1111113-112-3333233233333-113-------------1-----11---2113233111-------611-111111-1-----3-----------1------5------1131-22222112 ----647-9532356A9ACGEEAHGHE7755557878878888555DC8ECGQGGG986989D8A36B7656B4A566766888A844-QnM9BLCDBBC959E8811dCZLJ8AAKA76CECIUP6V6m*J1NES8753B24VK75563L5B96EA7G7755CFEDBAGPQE941635k23289BDLEAFE6AB257O ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 100.0 SQ:SECSTR cEEcTTccEEEcccEEcccccccHHHHHHHHHHHHTccEEEccGGGccHHHHHHHHHHHTccGGGcEEEEEEcGGGccHHHHHHHHHHHHHHHTcccccEEEEccccEEcTTTHHHHHHHHHHHHHTTccccEEEEcccHHHHHHHHHHcccccccEEEEEccTTcccHHHHHHHHHHTcEEEEEcTTGGGTTTTcHHHHHHHHHHTccHHHHHHHHHHHTTcEEccccccHHHHHHHTccccccccHHHHHHHHTTcccccccccEEcEETTE PSIPRED cEEcccccEEccEEEEcccccHHHHHHHHHHHHHccccEEEcHHHcccHHHHHHHHHHccccHHHEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHccccccccccEEcccccccHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEEccccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccc //