[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : dksA
DDBJ      :dksA         RNA polymerase-binding protein DksA
Swiss-Prot:DKSA_SALTY   RecName: Full=DnaK suppressor protein;

Homologs  Archaea  0/68 : Bacteria  430/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.2.14g.39.1
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->151 1tjlA PDBj 2e-71 98.6 %
:RPS:SCOP  7->110 1tjlA1  a.2.14.1 * 7e-34 83.7 %
:RPS:SCOP  111->151 1tjlA2  g.39.1.13 * 8e-12 100.0 %
:HMM:SCOP  7->110 1tjlA1 a.2.14.1 * 2.8e-36 51.9 %
:HMM:SCOP  111->151 1tjlA2 g.39.1.13 * 3.6e-12 51.2 %
:RPS:PFM   109->143 PF01258 * zf-dskA_traR 2e-05 62.9 %
:HMM:PFM   110->142 PF01258 * zf-dskA_traR 1.2e-11 42.4 33/36  
:BLT:SWISS 1->151 DKSA_SALTY 2e-75 100.0 %
:PROS 114->138|PS01102|ZF_DKSA_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67280.1 GT:GENE dksA GT:PRODUCT RNA polymerase-binding protein DksA GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(224081..224536) GB:FROM 224081 GB:TO 224536 GB:DIRECTION - GB:GENE dksA GB:PRODUCT RNA polymerase-binding protein DksA GB:NOTE identified by match to protein family HMM PF01258; match to protein family HMM TIGR02420 GB:PROTEIN_ID ACF67280.1 GB:DB_XREF GI:194407061 GB:GENE:GENE dksA LENGTH 151 SQ:AASEQ MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILEAWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG GT:EXON 1|1-151:0| SW:ID DKSA_SALTY SW:DE RecName: Full=DnaK suppressor protein; SW:GN Name=dksA; OrderedLocusNames=STM0186; SW:KW Complete proteome; Metal-binding; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->151|DKSA_SALTY|2e-75|100.0|151/151| GO:SWS:NREP 1 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 114->138|PS01102|ZF_DKSA_1|PDOC00846| SEG 91->105|rerklikkiektlkk| BL:PDB:NREP 1 BL:PDB:REP 7->151|1tjlA|2e-71|98.6|145/145| RP:PFM:NREP 1 RP:PFM:REP 109->143|PF01258|2e-05|62.9|35/36|zf-dskA_traR| HM:PFM:NREP 1 HM:PFM:REP 110->142|PF01258|1.2e-11|42.4|33/36|zf-dskA_traR| GO:PFM:NREP 1 GO:PFM GO:0008270|"GO:zinc ion binding"|PF01258|IPR000962| RP:SCP:NREP 2 RP:SCP:REP 7->110|1tjlA1|7e-34|83.7|104/104|a.2.14.1| RP:SCP:REP 111->151|1tjlA2|8e-12|100.0|41/41|g.39.1.13| HM:SCP:REP 7->110|1tjlA1|2.8e-36|51.9|104/0|a.2.14.1|1/1|DnaK suppressor protein DksA, alpha-hairpin domain| HM:SCP:REP 111->151|1tjlA2|3.6e-12|51.2|41/41|g.39.1.13|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 454 OP:NHOMOORG 431 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111---11-----111111111111111-----1111111111111111111111111111111111111111111111111111111132212111111111111121-1111111121111111111111121121111-------------------------112211111111111111111111111111111-1121211-11121111111111111111-1111111111111111111112111111111111111111111211111111-11111111111111111111111111121111111111111111111111111111111112212122211111---------11111111111111111111111111111111-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 96.0 SQ:SECSTR ######ccccccHHHHHTTcccccccTTccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccHHHHHHcTTccccHHHHHHHHHHHHHHHc DISOP:02AL 1-12,29-29,54-54,56-71,143-152| PSIPRED ccccHHccccccccHHHccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHccccccHHHHHHcccccccHHHHHHHHHHHHHHcc //