[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : dmsB.1
DDBJ      :dmsB         dimethylsulfoxide reductase, chain B
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  505/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->170 1kqfB PDBj 2e-29 39.7 %
:RPS:PDB   71->172 1a6lA PDBj 5e-13 15.0 %
:RPS:SCOP  13->170 1kqfB1  d.58.1.5 * 7e-40 34.8 %
:HMM:SCOP  13->196 1q16B_ d.58.1.5 * 2e-66 43.4 %
:HMM:PFM   18->34 PF00037 * Fer4 2.7e-06 47.1 17/24  
:HMM:PFM   105->126 PF00037 * Fer4 5.2e-12 50.0 22/24  
:BLT:SWISS 14->205 DMSB_SHIFL 1e-62 56.8 %
:PROS 111->122|PS00198|4FE4S_FER_1
:REPEAT 2|19->101|106->168

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69054.1 GT:GENE dmsB.1 GT:PRODUCT dimethylsulfoxide reductase, chain B GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2718966..2719595) GB:FROM 2718966 GB:TO 2719595 GB:DIRECTION - GB:GENE dmsB GB:PRODUCT dimethylsulfoxide reductase, chain B GB:NOTE identified by match to protein family HMM PF00037; match to protein family HMM TIGR02951 GB:PROTEIN_ID ACF69054.1 GB:DB_XREF GI:194408835 GB:GENE:GENE dmsB LENGTH 209 SQ:AASEQ MSQFTHYPPVSDKQLGFFIDSSRCSGCKACQVACKDKNNLEVGRRFRRVYEVKGGSFIPTGQGGVSNNVFAYTLSISCNHCADPVCTKNCPTTAMHKRPGDGIVRVDTDKCVGCGYCAWSCPYGAPQLNEQTGQMSKCDMCVDLLAKGESPVCVATCPLEAIKFGPIDELRAKYGSVCDVNGLPDSSITKPNLVVKAHQGAEKEGKRHA GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 14->205|DMSB_SHIFL|1e-62|56.8|190/205| PROS 111->122|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|19->101|106->168| BL:PDB:NREP 1 BL:PDB:REP 19->170|1kqfB|2e-29|39.7|151/289| RP:PDB:NREP 1 RP:PDB:REP 71->172|1a6lA|5e-13|15.0|100/106| HM:PFM:NREP 2 HM:PFM:REP 18->34|PF00037|2.7e-06|47.1|17/24|Fer4| HM:PFM:REP 105->126|PF00037|5.2e-12|50.0|22/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 13->170|1kqfB1|7e-40|34.8|158/244|d.58.1.5| HM:SCP:REP 13->196|1q16B_|2e-66|43.4|175/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2449 OP:NHOMOORG 562 OP:PATTERN 22121222344333325-5574473113-1131-432333233-1--13-2-222115262---4--- -7A11-11111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------6dS334222-----------------1-11----------------2243333332344411333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------134-11111111-1-1411-111--1--9--13pl3355-5AB11131---831--1------21--323-32--11111111112-1132122511----------1-1121-11212-1--31211111111311--8-3-------------------------------111-122-3211212233333323444413222334211232241443325213124-1-23----------B3418E558BC7CAAAF198797693-BABA343827422112211-2-------2A3321173-111-----46997-5H9A9787BA8J8---1842------C5D999-GHHFGFEEGG-GGFHGFFGFGHFGEGGGG99998621BGEFFGGGGGGFEGEFF6AA9EDEF--455555555555---1---------1112-444434133232114-------1-12-22221-1--11114-------------2333111114422322------------123--------------------------------------------11--11111-21 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 78.0 SQ:SECSTR ###########TTEEEEEEccGGGGccccccTcccTTcccTTcccccccccccccccccHHHHHHHHHHHcEEEcGGGTTTcccHHHHHcTTccEEEccccccEEEcTTTcccccccTTTcTTccEEEGGGccGGGTHHHHHHHHHHTTcccccccccccTTHHHHTTcccGGG################################### DISOP:02AL 1-2,4-4,197-210| PSIPRED cccccccccccccEEEEEEcHHHcccccHHHHHHHHHHccccccccEEEEEEccccEEEccccccccccEEEEEEEccccccccHHHHHccccccEEcccccEEEEcHHHcccccHHHHHcccccEEEEccccEEEEEcccHHHHHcccccEEHHHcccccEEEEEHHHHHHHHHHHHHHccccccccccccEEEEccccccccccccc //