[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : dmsC1
DDBJ      :dmsC1        anaerobic dimethyl sulfoxide reductase,  C subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:287 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->275 PF04976 * DmsC 6e-56 52.0 %
:HMM:PFM   1->277 PF04976 * DmsC 2.6e-116 51.8 276/276  
:BLT:SWISS 1->287 DMSC_ECOLI e-129 82.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67494.1 GT:GENE dmsC1 GT:PRODUCT anaerobic dimethyl sulfoxide reductase, C subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1052786..1053649 GB:FROM 1052786 GB:TO 1053649 GB:DIRECTION + GB:GENE dmsC1 GB:PRODUCT anaerobic dimethyl sulfoxide reductase, C subunit GB:NOTE identified by match to protein family HMM PF04976 GB:PROTEIN_ID ACF67494.1 GB:DB_XREF GI:194407275 GB:GENE:GENE dmsC1 LENGTH 287 SQ:AASEQ MGSGWHEWPLMIFTVFGQCVAGGFIVLALALMKGDLRAETQQRVIACMFGLWVLMGIGFIASMLHLGSPMRAFNSLNRVGASALSNEIASGSVFFAVGGIGWLLAVLKKLPPALRTLWLIITMVLGVVFVWMMVRVYNSIDTVPTWYSVWTPLGFFLTLFMGGSLLGYLLLRIAGVNGWAMRLLPAVSVLALVVIAIMVAMQGAELATIHSSIQQASALVPDYGSLMAWRMVLLAAALCCWIVPQLKGYQPAVPLLSVAFILMLAGELIGRGVFYGLHMTVGMAVAS GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 1->287|DMSC_ECOLI|e-129|82.2|287/287| TM:NTM 7 TM:REGION 10->32| TM:REGION 43->65| TM:REGION 86->107| TM:REGION 114->136| TM:REGION 152->174| TM:REGION 181->203| TM:REGION 237->259| SEG 103->114|llavlkklppal| SEG 183->201|llpavsvlalvviaimvam| RP:PFM:NREP 1 RP:PFM:REP 6->275|PF04976|6e-56|52.0|269/272|DmsC| HM:PFM:NREP 1 HM:PFM:REP 1->277|PF04976|2.6e-116|51.8|276/276|DmsC| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF04976|IPR007059| GO:PFM GO:0019645|"GO:anaerobic electron transport chain"|PF04976|IPR007059| OP:NHOMO 201 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------------------- -------------1-------------------------------------------------1---------------221----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------55-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------1------------------------221-11-2222221222-222222222222222222-222----1434344444444443412222222---22222222222------------------1111-1-1111---1----------------------------------------111-----11---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,287-288| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccc //