[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : dpaL
DDBJ      :dpaL         diaminopropionate ammonia-lyase
Swiss-Prot:DPAL_SALTY   RecName: Full=Diaminopropionate ammonia-lyase;         Short=Diaminopropionatase;         EC=4.3.1.15;AltName: Full=Alpha,beta-diaminopropionate ammonia-lyase;

Homologs  Archaea  4/68 : Bacteria  241/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:404 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->283 1tdjA PDBj 1e-12 32.2 %
:RPS:PDB   46->400 2c2bA PDBj 2e-32 14.9 %
:RPS:SCOP  46->401 1tdjA1  c.79.1.1 * 1e-37 22.7 %
:HMM:SCOP  25->375 1v71A1 c.79.1.1 * 2.9e-53 29.5 %
:RPS:PFM   121->333 PF00291 * PALP 1e-14 34.5 %
:HMM:PFM   42->330 PF00291 * PALP 2.2e-43 30.1 236/297  
:BLT:SWISS 1->404 DPAL_SALTY 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66180.1 GT:GENE dpaL GT:PRODUCT diaminopropionate ammonia-lyase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1098227..1099441 GB:FROM 1098227 GB:TO 1099441 GB:DIRECTION + GB:GENE dpaL GB:PRODUCT diaminopropionate ammonia-lyase GB:NOTE identified by match to protein family HMM PF00291; match to protein family HMM TIGR01747; match to protein family HMM TIGR03528 GB:PROTEIN_ID ACF66180.1 GB:DB_XREF GI:194405961 GB:GENE:GENE dpaL LENGTH 404 SQ:AASEQ MHELIKYQFNTRRKKYGTGAALSLLNGNVGHEVLAFHKKLPNYAVTPLHNLAHLSQRLGLGSIHIKDESWRFGLNAFKGLGGSYAVGKYLADKLQCDINSLSFAALNTPEIKEKIKDCVFVTATDGNHGRGVAWAAEQLGLKAVVYMPKGSSLIRAENIRHHGAECTITDLNYDDAVRLAHRMAQTKGWVLLQDTAWTGYEEIPTWIMQGYMTLAVEAYEQLAETNSPLPTHLILQAGVGSFAGSVMGYFVEKMQENIPNIIVVEPHQANCLYQSAVMDDGQPHCVTGDMATIMAGLACGEPNIISWPIIRDNTSCFISADDCLAAKGMRISAAPRPGTDTPFISGESGAIGVGLLYELMNNMHYQDLANRLQLDASAHVLLISTEGDTSPDIYEDIVWNGRSA GT:EXON 1|1-404:0| SW:ID DPAL_SALTY SW:DE RecName: Full=Diaminopropionate ammonia-lyase; Short=Diaminopropionatase; EC=4.3.1.15;AltName: Full=Alpha,beta-diaminopropionate ammonia-lyase; SW:GN Name=dpaL; OrderedLocusNames=STM1002; SW:KW Complete proteome; Direct protein sequencing; Lyase;Pyridoxal phosphate. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->404|DPAL_SALTY|0.0|100.0|404/404| GO:SWS:NREP 1 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 30->283|1tdjA|1e-12|32.2|214/494| RP:PDB:NREP 1 RP:PDB:REP 46->400|2c2bA|2e-32|14.9|308/443| RP:PFM:NREP 1 RP:PFM:REP 121->333|PF00291|1e-14|34.5|194/293|PALP| HM:PFM:NREP 1 HM:PFM:REP 42->330|PF00291|2.2e-43|30.1|236/297|PALP| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00291|IPR001926| GO:PFM GO:0008152|"GO:metabolic process"|PF00291|IPR001926| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00291|IPR001926| RP:SCP:NREP 1 RP:SCP:REP 46->401|1tdjA1|1e-37|22.7|300/331|c.79.1.1| HM:SCP:REP 25->375|1v71A1|2.9e-53|29.5|305/0|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 365 OP:NHOMOORG 292 OP:PATTERN 11---1-------------------------------------------------------1------ -----------11------------------------1111-------1---1111-1--------1-----------1---1-----------------1-----------------------------------1---1--------1---1---------1---111-------------2-1-----------------------------------11--------1---------------------1-------1--------1----1---------------------------------------------------21111111212-211--1-21-1--11--11-2---1-------11----111-------111--1-------------------1--1---2-------12-111-------1-----111--------2------------------------------------1--1---11-1211112-----11--------11--1------------1111--------1----1-1-1-1--------1--11---------------11-1------------------------11-----21--1-1---1-------2------1---1---1---------1-112112222222222-2222222222222222221212-1111212221222221212212111112--111111111111-----------------1111-11-111-1111--------1-1-11111-1--1211-222---------1---1111111-111---------------1-1-------------------------1----------------------------- ------------222111-1111212111----1111111111-----111121111-1-----1-------------------------2-1---------1-----2------------------------------------------------------1-------------------------1-----1121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 372 STR:RPRED 92.1 SQ:SECSTR #############################HHHTccGGGcccccccccEEEcHHHHHHHTcccEEEEETTcccccccTHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHTTcccccEEEEccccHHHHHHHHHHHHTTccEEEEEETTTcccTTHHHHHTTcEEEEEcccHHHHHHHHHHHHHHccEEEcccccccccTTccHHHHHHHTHHHHHHHHHTHHHTTccccEEEEEccccHHHHHHHHHHHHTccccccEEEEEEEGGGcHHHHHHTTTccccccccEccccccGGGcccccTTHHHHHHHHTTcEEEEEcHHHHHHHHHHHHTTTHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHTTcccTTccEEEEEccGGGccHHHHHHHTTc### DISOP:02AL 1-1,15-15,17-18,403-405| PSIPRED ccccHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccEEcHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccEEEEccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHcccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEEccccccHHHHHccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHccccccEEEccHHHHHHHHHHHHHHcccHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHcccc //