[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : engD
DDBJ      :engD         GTP-binding protein EngD
Swiss-Prot:ENGD_SHIFL   RecName: Full=GTP-dependent nucleic acid-binding protein engD;

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.15.10
:363 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->363 1jalA PDBj e-152 76.7 %
:RPS:PDB   4->362 2dwqB PDBj 2e-98 46.7 %
:RPS:SCOP  2->278 1ni3A1  c.37.1.8 * 1e-48 35.5 %
:RPS:SCOP  279->363 1jalA2  d.15.10.2 * 1e-34 77.6 %
:HMM:SCOP  3->301 1wxqA1 c.37.1.8 * 2e-87 48.8 %
:HMM:SCOP  279->363 1jalA2 d.15.10.2 * 6.3e-36 68.2 %
:RPS:PFM   14->111 PF01926 * MMR_HSR1 8e-20 63.4 %
:RPS:PFM   279->362 PF06071 * YchF-GTPase_C 4e-33 71.4 %
:HMM:PFM   279->362 PF06071 * YchF-GTPase_C 3.1e-43 65.5 84/84  
:HMM:PFM   14->132 PF01926 * MMR_HSR1 5.5e-23 38.7 93/108  
:BLT:SWISS 1->363 ENGD_SHIFL 0.0 93.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67366.1 GT:GENE engD GT:PRODUCT GTP-binding protein EngD GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1929626..1930717 GB:FROM 1929626 GB:TO 1930717 GB:DIRECTION + GB:GENE engD GB:PRODUCT GTP-binding protein EngD GB:NOTE identified by match to protein family HMM PF01926; match to protein family HMM PF06071; match to protein family HMM TIGR00092 GB:PROTEIN_ID ACF67366.1 GB:DB_XREF GI:194407147 GB:GENE:GENE engD LENGTH 363 SQ:AASEQ MGFKCGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPMPDPRLDQLAEIVKPQRILPTTMEFVDIAGLVKGASKGEGLGNQFLTNIRETEAIGHVVRCFENDNIIHVAGKVNPAEDIDVINTELALADLDTCERAIHRVQKKAKGGDKDAKAELAALEKCLPHLAEAGMLRSLDLTDEDKAAIRYLSFLTLKPTMYIANVNEDGFENNPYLDQVREIAAKEGSVVVPVCAAVEADIAELDDDERDEFMAELGLEEPGLNRVIRAGYRLLNLQTYFTAGVKEVRAWTIPVGATAPQAAGKIHTDFEKGFIRAQTIAFDDFITYKGEQGAKEAGKMRAEGKDYIVKDGDIMNFLFNV GT:EXON 1|1-363:0| SW:ID ENGD_SHIFL SW:DE RecName: Full=GTP-dependent nucleic acid-binding protein engD; SW:GN Name=engD; OrderedLocusNames=SF1206, S1290; SW:KW Complete proteome; GTP-binding; Magnesium; Metal-binding;Nucleotide-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->363|ENGD_SHIFL|0.0|93.4|363/363| GO:SWS:NREP 3 GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 149->167|kkakggdkdakaelaalek| BL:PDB:NREP 1 BL:PDB:REP 1->363|1jalA|e-152|76.7|348/348| RP:PDB:NREP 1 RP:PDB:REP 4->362|2dwqB|2e-98|46.7|332/337| RP:PFM:NREP 2 RP:PFM:REP 14->111|PF01926|8e-20|63.4|82/105|MMR_HSR1| RP:PFM:REP 279->362|PF06071|4e-33|71.4|84/84|YchF-GTPase_C| HM:PFM:NREP 2 HM:PFM:REP 279->362|PF06071|3.1e-43|65.5|84/84|YchF-GTPase_C| HM:PFM:REP 14->132|PF01926|5.5e-23|38.7|93/108|MMR_HSR1| GO:PFM:NREP 2 GO:PFM GO:0005525|"GO:GTP binding"|PF01926|IPR002917| GO:PFM GO:0005622|"GO:intracellular"|PF01926|IPR002917| RP:SCP:NREP 2 RP:SCP:REP 2->278|1ni3A1|1e-48|35.5|276/296|c.37.1.8| RP:SCP:REP 279->363|1jalA2|1e-34|77.6|85/85|d.15.10.2| HM:SCP:REP 3->301|1wxqA1|2e-87|48.8|297/0|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 279->363|1jalA2|6.3e-36|68.2|85/0|d.15.10.2|1/1|TGS-like| OP:NHOMO 2286 OP:NHOMOORG 1172 OP:PATTERN 11111111111111111111111122231222111111111111111111111122222221111112 2221222222222222222-222222222222222222222222222222212222221122222222222222222222222222122222222221-2222222222222222222222222222222222222222222222222222222222112111212222222122222122222222221222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222223222222222222222222222222222222222222222222232223222222222222211122222222222222222222222222222-22222222222222222222222222112222222222222222222222222223322222222222222222222222111121112222222111111111111111111111111111111111211111112212211111111111111111212223222222222222222222222222222222222222222222222222222222221112122121212222212111111221222-2111122122211221121111111111-11111111111111111111112222211111111111111111111111121122222222222222122222222211222222222122221221111111122212111122222222222221111111112111111111111311111111111222222222222222222222221221222-22222222222222122222122222222232 1122335-52214452323233322223333232322333333333422333332212212233443333324342333334434433-12131111111121232148474222211111121641417G2-22111112113211-1111121122136622233533412333446c6564555883446465445 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 363 STR:RPRED 100.0 SQ:SECSTR HHHcEEEEccccccHHHHHHHHHHHHTccccEEEEEcccHHHHHEcccHHHHHTccTTccccEEccEEEEEETTTTcccccccccTTcHHHHHHHHccEEEEcEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHHHHHTTccGGGccccccTTHHHHHcccGGGccEEccEEccTTTTTTcHHHHHHHHHHHHHTccccEEcHHHHHHTTTcTHHHHHHHHHHTTccccHHHHHHHHHHHHTTEEEEEEcccccEEEEEEETTccHHHHHHTTcTHHHHHEEEEEEEEHHHHHHHccHHHHHHHTccEEEcccccccTTEEEEEEEcc DISOP:02AL 1-1| PSIPRED ccEEEEEEEcccccHHHHHHHHHccccccccccccccccEEEEEEcccccEEEEEEEEcccEEcccEEEEEEcccHHccccccccHHHHHHHHHHHccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHccEEEEEEccHHcccccHHHHHHHHHHHHccccEEEEEHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHcccEEEEEccccccccEEEcccccHHHHHHHHHHHHHHccEEEEEEcccHHHHcccHHHHHHcccEEEcccEEEEccccEEEEEEcc //