[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : entA
DDBJ      :entA         2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  866/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->251 2fwmX PDBj 1e-81 86.7 %
:RPS:PDB   7->249 1a27A PDBj 6e-34 17.3 %
:RPS:SCOP  10->249 1pwxA  c.2.1.2 * 2e-38 18.5 %
:HMM:SCOP  4->246 1zemA1 c.2.1.2 * 6.1e-73 40.7 %
:RPS:PFM   13->147 PF00106 * adh_short 2e-07 31.9 %
:HMM:PFM   9->163 PF00106 * adh_short 3.6e-29 31.8 151/167  
:BLT:SWISS 5->251 ENTA_ECOLI e-107 87.9 %
:PROS 134->162|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68022.1 GT:GENE entA GT:PRODUCT 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 708351..709106 GB:FROM 708351 GB:TO 709106 GB:DIRECTION + GB:GENE entA GB:PRODUCT 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase GB:NOTE identified by match to protein family HMM PF00106; match to protein family HMM PF08659 GB:PROTEIN_ID ACF68022.1 GB:DB_XREF GI:194407803 GB:GENE:GENE entA LENGTH 251 SQ:AASEQ MTGFDFSDKTVWVTGAGKGIGYATALAFVDAGARVIGFDREFTQENYPFATEVMDVADAAQVAQVCQRVLQKTTRLDVLVNAAGILRMGATDALSVDDWQQTFAVNVGGAFNLFSQTMAQFRRQQGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALTVGLELAGCGVRCNVVSPGSTDTDMQRTLWVSEDAEQQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTLGA GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 5->251|ENTA_ECOLI|e-107|87.9|247/248| PROS 134->162|PS00061|ADH_SHORT|PDOC00060| SEG 56->71|vadaaqvaqvcqrvlq| SEG 149->159|askaalkslal| BL:PDB:NREP 1 BL:PDB:REP 5->251|2fwmX|1e-81|86.7|211/212| RP:PDB:NREP 1 RP:PDB:REP 7->249|1a27A|6e-34|17.3|243/285| RP:PFM:NREP 1 RP:PFM:REP 13->147|PF00106|2e-07|31.9|135/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 9->163|PF00106|3.6e-29|31.8|151/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 10->249|1pwxA|2e-38|18.5|238/252|c.2.1.2| HM:SCP:REP 4->246|1zemA1|6.1e-73|40.7|243/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 8152 OP:NHOMOORG 1096 OP:PATTERN 222123256464544315-121215225143411---------11131--321-22111-32523-34 BEF1Q1-233725-EPKBB-BP22LfBABBBDXWXYGRqj4G5lCE721771GA7523117CF1A6JNMFA1111---1252I11111553623111--44E166T5H3811111111111111122132211231B779A222A645673242111111423251874H411111111111278367441C6DAABABDAAAACBBCBF9BBAEA9B7DFCEC5444443BQ6333332333333326884861814415-1-7A44554756734453332555322222322222223433434444444311111111443558333333333452662453332115622264122124323335412918S88I12111G6kPN435IIJIFCDDDBCCCDDH-EIJFAZAHOdJ1cPPESOXlhfdYPQ9D7CDNG9FIA9D44444444EHG946751111111111-12233122122212111157We93GVQIQaXaabYJIHIGNNdgIJJI8HoLmGfdM46FFCB5D65GDLAXT59532477523321221-3F745936411111422113533753635843EG3312111111111111111111211113376566865C5243436478655474445451-2234611-1119CE95E37BB6787887-B888877887B89567768EIE9645A6656667667566666K777555711688888888888111434232656624BID11142611111123199BB92A254E5IJEGAFELCDBKGBHEG4433323341244B4444487489CAECFCD89A63431132887666--------1-3----------1--------------2232164676142 11--548-1-1-165CGACEEHANJNK796A9AAD94D5A8AB887ABDDDLNM6774533431413211--1131-111311243-6-789G8B63431515785-684f7A8782--1--4155-6-BI6-523111-51371152-27--42655GPKG4GCBB8582AN793422F1113A6H7IBF233A3227 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 100.0 SQ:SECSTR ccGGccccEEEEEcccccHHHHHHHHHHHTcTTccEEEEEHHHTTccTTcEEEEEccTTcHHHHHHHHHTcTTccccEEEEcccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTcEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEccccccTTTTccccHHHcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEcccTTccTTcHHHcc DISOP:02AL 1-2| PSIPRED cccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEcccccccc //