[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : entB
DDBJ      :entB         isochorismatase
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  185/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.28.1c.33.1
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->282 2fq1B PDBj e-141 84.9 %
:RPS:PDB   29->195 2a67A PDBj 4e-32 17.3 %
:RPS:PDB   217->282 2cq8A PDBj 2e-04 15.2 %
:RPS:SCOP  2->207 1nf8A  c.33.1.3 * 3e-58 47.1 %
:HMM:SCOP  1->246 1nbaA_ c.33.1.3 * 5.6e-62 41.6 %
:HMM:SCOP  211->282 1or5A_ a.28.1.1 * 1.9e-05 26.4 %
:RPS:PFM   31->204 PF00857 * Isochorismatase 4e-16 31.8 %
:HMM:PFM   32->204 PF00857 * Isochorismatase 8e-39 29.7 172/174  
:HMM:PFM   217->275 PF00550 * PP-binding 9.4e-11 30.5 59/67  
:BLT:SWISS 1->285 ENTB_SHIFL e-142 84.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68258.1 GT:GENE entB GT:PRODUCT isochorismatase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 707494..708351 GB:FROM 707494 GB:TO 708351 GB:DIRECTION + GB:GENE entB GB:PRODUCT isochorismatase GB:NOTE identified by match to protein family HMM PF00550; match to protein family HMM PF00857 GB:PROTEIN_ID ACF68258.1 GB:DB_XREF GI:194408039 GB:GENE:GENE entB LENGTH 285 SQ:AASEQ MAIPKLQSYALPTALDIPTNKVNWAFEPERAALLIHDMQDYFVSFWGRNCPMMDQVIANIAALRQYCKEHHIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQKVVEALTPDEADTVLVKWRYSAFHRSPLEQMLKDTGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALADFSREEHLMALNYVAGRSGRVVMTESLLPTPVPASKAALRALILPLLDETDEPLDDENLIDYGLDSVRMMGLAARWRKVHGDIDFVMLAKNPTIDAWWALLSRGVE GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 1->285|ENTB_SHIFL|e-142|84.6|285/285| SEG 223->236|lplldetdepldde| BL:PDB:NREP 1 BL:PDB:REP 4->282|2fq1B|e-141|84.9|279/279| RP:PDB:NREP 2 RP:PDB:REP 29->195|2a67A|4e-32|17.3|150/163| RP:PDB:REP 217->282|2cq8A|2e-04|15.2|66/110| RP:PFM:NREP 1 RP:PFM:REP 31->204|PF00857|4e-16|31.8|173/173|Isochorismatase| HM:PFM:NREP 2 HM:PFM:REP 32->204|PF00857|8e-39|29.7|172/174|Isochorismatase| HM:PFM:REP 217->275|PF00550|9.4e-11|30.5|59/67|PP-binding| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 2->207|1nf8A|3e-58|47.1|204/207|c.33.1.3| HM:SCP:REP 1->246|1nbaA_|5.6e-62|41.6|238/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| HM:SCP:REP 211->282|1or5A_|1.9e-05|26.4|72/82|a.28.1.1|1/1|ACP-like| OP:NHOMO 261 OP:NHOMOORG 225 OP:PATTERN 11111111111111111111111-11111111-----------1-------1-1-------------- --1-1------11-2----------------------111---1---------------------11-111-----------1-------------------------------------------------------------12------------------------------------------11---22222211221121211-11-2212----1---------1-111111111111111---1--------------------------------------------------------------------------------------------------------------1---------11-----------------------111111111-------------------------1---1----1--------------------------------------------------------------------11--------------1-----------------------------1------------------------------------------12-1---------------------------11---1-------------------------------------1121-2-1111111111-11211111111111111112222121-111111111111111111111111-----------------------------1-2---------------22222-1---1-2222----1-----111-------------1111112--1111-------------------------------------------------------------111-1111-- -----------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------1--1-21--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 280 STR:RPRED 98.2 SQ:SECSTR ##cccccccccccGGGcccccccccccTccEEEEEEcccTTcccccccccTTHHHHHHHHHHHHHHHHHTTccEEEEEEcccTTcTTHHHHHHHccTTccTTcTTTcccTTccccTTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHHTcEEEcTTcEEccccccccHHHHHHHHHHcHHHcTTTcEEHHHHccTTcTTHHHHHHHccccccccTTccHHHHHccTTHHHHHHHHHHHHHTcccccHHHHcccHHHHHHHHHH### DISOP:02AL 1-1,285-286| PSIPRED cccccccccccccHHHcccccccccccccccEEEEEcccHHHccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHccccccccccccHHHHHHHHccccccEEEEccccccccccHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHcccEEEEHHHccccHHHcccHHHHHHHHHHHcccccccccccHHHHcHHHHHHHHHHHHHHHcccEEcHHHHHHcccHHHHHHHHHHHcc //