[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : epaP.1
DDBJ      :epaP         type III secretion apparatus protein, YscR/HrcR family
Swiss-Prot:YSCR_SALTY   RecName: Full=Virulence protein yscR;

Homologs  Archaea  0/68 : Bacteria  498/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->210 PF00813 * FliP 2e-37 50.3 %
:HMM:PFM   13->211 PF00813 * FliP 3.9e-71 50.0 194/194  
:BLT:SWISS 1->215 YSCR_SALTY e-108 100.0 %
:PROS 143->158|PS01060|FLIP_1
:PROS 191->203|PS01061|FLIP_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67484.1 GT:GENE epaP.1 GT:PRODUCT type III secretion apparatus protein, YscR/HrcR family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1504259..1504906 GB:FROM 1504259 GB:TO 1504906 GB:DIRECTION + GB:GENE epaP GB:PRODUCT type III secretion apparatus protein, YscR/HrcR family GB:NOTE identified by match to protein family HMM PF00813; match to protein family HMM TIGR01102 GB:PROTEIN_ID ACF67484.1 GB:DB_XREF GI:194407265 GB:GENE:GENE epaP LENGTH 215 SQ:AASEQ MSLPDSPLQLIGILFLLSILPLIIVMGTSFLKLAVVFSILRNALGIQQVPPNIALYGLALVLSLFIMGPTLLAVKERWHPVQVAGAPFWTSEWDSKALAPYRQFLQKNSEEKEANYFRNLIKRTWPEDIKRKIKPDSLLILIPAFTVSQLTQAFRIGLLIYLPFLAIDLLISNILLAMGMMMVSPMTISLPFKLLIFLLAGGWDLTLAQLVQSFS GT:EXON 1|1-215:0| SW:ID YSCR_SALTY SW:DE RecName: Full=Virulence protein yscR; SW:GN Name=yscR; OrderedLocusNames=STM1419; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Virulence. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->215|YSCR_SALTY|e-108|100.0|215/215| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| PROS 143->158|PS01060|FLIP_1|PDOC00812| PROS 191->203|PS01061|FLIP_2|PDOC00812| TM:NTM 5 TM:REGION 15->37| TM:REGION 54->75| TM:REGION 134->156| TM:REGION 158->180| TM:REGION 183->205| SEG 8->24|lqligilfllsilplii| RP:PFM:NREP 1 RP:PFM:REP 25->210|PF00813|2e-37|50.3|181/193|FliP| HM:PFM:NREP 1 HM:PFM:REP 13->211|PF00813|3.9e-71|50.0|194/194|FliP| GO:PFM:NREP 2 GO:PFM GO:0009306|"GO:protein secretion"|PF00813|IPR005838| GO:PFM GO:0016020|"GO:membrane"|PF00813|IPR005838| OP:NHOMO 713 OP:NHOMOORG 499 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------1---1---1----1--------1-1------------------11111--------------------1-111111111111111--------------------1---------------------------------------------111111111111111111111111111111111111111111------------------------------------------------------------------------------------------11111111111111111111---111--11111111111111111111--11111111----113111111211211111111111-2222212222112111223111111-1111111111111--------1111-121--------------------------------111122213222432322-22214445131222111--112112111--12-111211141-------111-11111-1111111222211111111122-22-1-1111-1111111111111111111---13-111111111312131211121122221---111111111121122141331111122-3312221212313-11--1---2222233333333333333331-212-1251344444334343--2------1111--411-------------------------1122121112311111232---------1111211111331111122222223------111111111111111111--------------------------1-11111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,121-133| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //