[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : eprI.1
DDBJ      :eprI         type III secretion apparatus needle protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.20
:71 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   32->68 2ca5A PDBj 3e-07 32.4 %
:RPS:SCOP  1->67 2g0uA1  a.2.20.1 * 3e-13 22.7 %
:HMM:SCOP  1->67 2g0uA1 a.2.20.1 * 3.8e-19 38.8 %
:HMM:PFM   16->70 PF09392 * MxiH 2.3e-11 22.2 54/90  
:BLT:SWISS 2->70 YSCF_YEREN 9e-05 26.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66209.1 GT:GENE eprI.1 GT:PRODUCT type III secretion apparatus needle protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1495052..1495267 GB:FROM 1495052 GB:TO 1495267 GB:DIRECTION + GB:GENE eprI GB:PRODUCT type III secretion apparatus needle protein GB:NOTE identified by match to protein family HMM PF09392; match to protein family HMM TIGR02105 GB:PROTEIN_ID ACF66209.1 GB:DB_XREF GI:194405990 GB:GENE:GENE eprI LENGTH 71 SQ:AASEQ MDIAQLVDMLSHMAHQAGQAINDKMNGNDLLNPESMIKAQFALQQYSTFINYESSLIKMIKDMLSGIIAKI GT:EXON 1|1-71:0| BL:SWS:NREP 1 BL:SWS:REP 2->70|YSCF_YEREN|9e-05|26.1|69/87| RP:PDB:NREP 1 RP:PDB:REP 32->68|2ca5A|3e-07|32.4|37/62| HM:PFM:NREP 1 HM:PFM:REP 16->70|PF09392|2.3e-11|22.2|54/90|MxiH| RP:SCP:NREP 1 RP:SCP:REP 1->67|2g0uA1|3e-13|22.7|66/84|a.2.20.1| HM:SCP:REP 1->67|2g0uA1|3.8e-19|38.8|67/0|a.2.20.1|1/1|MxiH-like| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------1-1--------------------------------1---11--------1----1----1----------------1111111111111111--------1---------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 52.1 SQ:SECSTR ###############################cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH### DISOP:02AL 1-3,7-7| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //