[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : eprI.2
DDBJ      :eprI         type III secretion apparatus needle protein
Swiss-Prot:PRGI_SALTY   RecName: Full=Protein prgI;

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.20
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->77 2jowA PDBj 4e-40 97.4 %
:RPS:PDB   17->78 2ca5A PDBj 8e-16 69.4 %
:RPS:SCOP  5->75 2g0uA1  a.2.20.1 * 7e-20 54.9 %
:HMM:SCOP  2->75 2g0uA1 a.2.20.1 * 1.3e-19 44.6 %
:HMM:PFM   17->78 PF09392 * MxiH 6.2e-13 24.6 61/90  
:BLT:SWISS 1->80 PRGI_SALTY 4e-42 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66494.1 GT:GENE eprI.2 GT:PRODUCT type III secretion apparatus needle protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2990589..2990831) GB:FROM 2990589 GB:TO 2990831 GB:DIRECTION - GB:GENE eprI GB:PRODUCT type III secretion apparatus needle protein GB:NOTE identified by match to protein family HMM PF09392; match to protein family HMM TIGR02105 GB:PROTEIN_ID ACF66494.1 GB:DB_XREF GI:194406275 GB:GENE:GENE eprI LENGTH 80 SQ:AASEQ MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR GT:EXON 1|1-80:0| SW:ID PRGI_SALTY SW:DE RecName: Full=Protein prgI; SW:GN Name=prgI; OrderedLocusNames=STM2873; SW:KW 3D-structure; Complete proteome; Protein transport; Transport;Virulence. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->80|PRGI_SALTY|4e-42|100.0|80/80| GO:SWS:NREP 3 GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| GO:SWS GO:0009405|"GO:pathogenesis"|Virulence| BL:PDB:NREP 1 BL:PDB:REP 1->77|2jowA|4e-40|97.4|77/83| RP:PDB:NREP 1 RP:PDB:REP 17->78|2ca5A|8e-16|69.4|62/62| HM:PFM:NREP 1 HM:PFM:REP 17->78|PF09392|6.2e-13|24.6|61/90|MxiH| RP:SCP:NREP 1 RP:SCP:REP 5->75|2g0uA1|7e-20|54.9|71/84|a.2.20.1| HM:SCP:REP 2->75|2g0uA1|1.3e-19|44.6|74/0|a.2.20.1|1/1|MxiH-like| OP:NHOMO 36 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1-11-1------------------------------1--------------------------------------------------------------------------------------------------------------------------1-1-------1-11--------1-1--------------1111111111111111--111--11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 97.5 SQ:SECSTR ccccGGGcHHHccTHHccHHHHHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTc## DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcc //